AV03047
Anti-CDKN2B antibody produced in rabbit
affinity isolated antibody
Sinonimo/i:
Anti-Cyclin-dependent kinase inhibitor 2B (p15, inhibits CDK4)
Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali
About This Item
Codice UNSPSC:
12352203
NACRES:
NA.41
Origine biologica
rabbit
Coniugato
unconjugated
Forma dell’anticorpo
affinity isolated antibody
Tipo di anticorpo
primary antibodies
Clone
polyclonal
Stato
buffered aqueous solution
PM
15 kDa
Reattività contro le specie
human, pig
Concentrazione
0.5 mg - 1 mg/mL
tecniche
western blot: suitable
N° accesso NCBI
N° accesso UniProt
Condizioni di spedizione
wet ice
Temperatura di conservazione
−20°C
modifica post-traduzionali bersaglio
unmodified
Informazioni sul gene
human ... CDKN2B(1030)
Immunogeno
Synthetic peptide directed towards the middle region of human CDKN2B
Applicazioni
Anti-CDKN2B antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Azioni biochim/fisiol
CDKN2B has inhibitory effects on cell cycle progression. It binds to cyclin-dependent kinases and prevents their association with D-type cyclins. Methylation of CDKN2B has been associated with pathogenesis of pediatric myelodysplastic syndromes and in malignant hematopoiesis. Mutations in CDKN2B gene have been observed in malignant gliomas.
Sequenza
Synthetic peptide located within the following region: REGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
Stato fisico
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Esclusione di responsabilità
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Non trovi il prodotto giusto?
Prova il nostro Motore di ricerca dei prodotti.
Codice della classe di stoccaggio
12 - Non Combustible Liquids
Classe di pericolosità dell'acqua (WGK)
WGK 3
Punto d’infiammabilità (°F)
Not applicable
Punto d’infiammabilità (°C)
Not applicable
Scegli una delle versioni più recenti:
Certificati d'analisi (COA)
Lot/Batch Number
Non trovi la versione di tuo interesse?
Se hai bisogno di una versione specifica, puoi cercare il certificato tramite il numero di lotto.
Possiedi già questo prodotto?
I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.
Miyoung Kim et al.
Acta haematologica, 130(2), 115-121 (2013-04-11)
Transcriptional repression of tumor suppressor genes is determined by the quantity of promoter hypermethylation. We analyzed the methylation quantity of CDKN2B in pediatric myelodysplastic syndromes (MDS). Quantitative measurement of CDKN2B methylation was performed in 25 pediatric MDS patients and 12
Yanhong Liu et al.
Current opinion in genetics & development, 20(3), 239-244 (2010-03-10)
Recent advances in human genome studies have opened new avenues for the identification of susceptibility genes for many complex genetic disorders, especially in the field of rare cancers such as glioma. To date, eight glioma susceptibility loci have been identified
Utz Krug et al.
Oncogene, 21(21), 3475-3495 (2002-05-29)
Over the last decade, a growing number of tumor suppressor genes have been discovered to play a role in tumorigenesis. Mutations of p53 have been found in hematological malignant diseases, but the frequency of these alterations is much lower than
Moon-Taek Park et al.
Journal of biochemistry and molecular biology, 36(1), 60-65 (2003-01-25)
Cancer is frequently considered to be a disease of the cell cycle. As such, it is not surprising that the deregulation of the cell cycle is one of the most frequent alterations during tumor development. Cell cycle progression is a
Nerea Méndez-Barbero et al.
EBioMedicine, 46, 274-289 (2019-08-10)
Tumor necrosis factor-like weak inducer of apoptosis (Tnfsf12; TWEAK) and its receptor Fibroblast growth factor-inducible 14 (Tnfrsf12a; Fn14) participate in the inflammatory response associated with vascular remodeling. However, the functional effect of TWEAK on vascular smooth muscle cells (VSMCs) is
Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..
Contatta l'Assistenza Tecnica.