Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

APREST94489

Sigma-Aldrich

PrEST Antigen MYO15A

Prestige Antigens Powered by Atlas Antibodies

Sinonimo/i:

DFNB3, MYO15

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352203

Saggio

>80% (SDS-PAGE)

Stato

buffered aqueous solution

PM

predicted mol wt 28 kDa

Purificato mediante

immobilized metal affinity chromatography (IMAC)

Concentrazione

≥0.5 mg/mL

Sequenza immunogenica

LHPHLTRFLQDVSRTPGLPFQGIAKACEQNLQKTLRFGGRLELPSSIELRAMLAGRSSKRQLFLLPGGLERHLKIKTCTVALDVVEEICAEMA

N° accesso Ensembl | uomo

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

Informazioni sul gene

human ... MYO15A(51168)

Descrizione generale

Recombinant protein fragment of Human MYO15A with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag

Applicazioni

Blocking agent and positive assay control using corresponding antibodies.

Stato fisico

Solution in phosphate-buffered saline and 1M Urea, pH 7.4

Nota sulla preparazione

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 2

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documenti section.

Se ti serve aiuto, non esitare a contattarci Servizio Clienti

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.