APREST94472

PrEST Antigen EZH1

Prestige Antigens Powered by Atlas Antibodies

• Sinonimo/i: KIAA0388, KMT6B
• Codice UNSPSC: 12352203

Proprietà

• Ricombinante: expressed in E. coli
• Saggio: >80% (SDS-PAGE)
• Forma fisica: buffered aqueous solution
• PM: predicted mol wt 27 kDa
• Purificato mediante: immobilized metal affinity chromatography (IMAC)
• Concentrazione: ≥0.5 mg/mL
• Sequenza immunogenica: YKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGRRRRRHHIVSASCSNASASAVAETKEGDSDRDTGNDWASSSSE
• N° accesso Ensembl | uomo: ENSG00000108799
• N° accesso UniProt: Q92800
• Condizioni di spedizione: wet ice
• Temperatura di conservazione: −20°C
• Informazioni sul gene: human ... EZH1(2145)

Descrizione

Descrizione generale

Recombinant protein fragment of Human EZH1 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag

Applicazioni

Blocking agent and positive assay control using corresponding antibodies.

Stato fisico

Solution in phosphate-buffered saline and 1M Urea, pH 7.4

Nota sulla preparazione

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 2
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable