Passa al contenuto
Merck
Tutte le immagini(1)

Documenti fondamentali

APREST75066

Sigma-Aldrich

PrEST Antigen C7orf57

Prestige Antigens Powered by Atlas Antibodies, buffered aqueous solution

Autenticatiper visualizzare i prezzi riservati alla tua organizzazione & contrattuali


About This Item

Codice UNSPSC:
12352202

Ricombinante

expressed in E. coli

Saggio

>80% (SDS-PAGE)

Stato

buffered aqueous solution

PM

predicted mol wt 25 kDa

Purificato mediante

immobilized metal affinity chromatography (IMAC)

Concentrazione

≥0.5 mg/mL

Sequenza immunogenica

ISNGYKDEWLQQQQRADSDKRTPKTSRASVLSQSPRDLEGPQDAARLQDAEASEGPEDTPGPEESVSASTPA

N° accesso Ensembl | uomo

N° accesso UniProt

Condizioni di spedizione

wet ice

Temperatura di conservazione

−20°C

Informazioni sul gene

Descrizione generale

Recombinant protein fragment of Human C7ORF57 with N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) fusion tag.

Applicazioni

Suitable as a blocking agent using corresponding antibodies.

Linkage

Corresponding Antibody HPA021286.

Stato fisico

Solution in 1 M urea-PBS, pH 7.4

Nota sulla preparazione

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

Note legali

Prestige Antigens is a trademark of Sigma-Aldrich Co. LLC

Esclusione di responsabilità

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Codice della classe di stoccaggio

10 - Combustible liquids

Classe di pericolosità dell'acqua (WGK)

WGK 2

Punto d’infiammabilità (°F)

Not applicable

Punto d’infiammabilità (°C)

Not applicable


Scegli una delle versioni più recenti:

Certificati d'analisi (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documenti section.

Se ti serve aiuto, non esitare a contattarci Servizio Clienti

Possiedi già questo prodotto?

I documenti relativi ai prodotti acquistati recentemente sono disponibili nell’Archivio dei documenti.

Visita l’Archivio dei documenti

Il team dei nostri ricercatori vanta grande esperienza in tutte le aree della ricerca quali Life Science, scienza dei materiali, sintesi chimica, cromatografia, discipline analitiche, ecc..

Contatta l'Assistenza Tecnica.