Skip to Content
Merck
All Photos(1)

Key Documents

AV46009

Sigma-Aldrich

Anti-NCF4 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Ncf4 Antibody, Ncf4 Antibody - Anti-NCF4 antibody produced in rabbit, Anti-MGC3810, Anti-NCF, Anti-Neutrophil cytosolic factor 4, 40 kDa, Anti-P40PHOX, Anti-SH3PXD4

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

Pricing and availability is not currently available.

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

39 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

General description

The previously assigned protein identifier A8K4F9 has been merged into Q15080. Full details can be found on the UniProt database.

Immunogen

Synthetic peptide directed towards the N terminal region of human NCF4

Application

Anti-NCF4 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.

Biochem/physiol Actions

Anti-NCF4 antibody produced in rabbit is also referred as Anti-Neutrophil cytosolic factor 4, 40kDa, Anti-SH3PXD4 or Anti-P40PHOX.
P40PHOX is a cytosolic component of the activation complex NADPH oxidase that regulates membrane translocation of p67phox and p47phox through the PB1-PC interaction. It facilitates production of superoxide, a multicomponent enzyme system important for host defense. The Px domain of the protein interacts with lipid products of PI3K proposes its role in PI3 kinase-mediated signaling pathway.

Sequence

Synthetic peptide located within the following region: SKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


  • Choose from one of the most recent versions:

    Certificates of Analysis (COA)

    Lot/Batch Number

    Don't see the Right Version?

    If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

    Already Own This Product?

    Find documentation for the products that you have recently purchased in the Document Library.

    Visit the Document Library

    F Kanai et al.
    Nature cell biology, 3(7), 675-678 (2001-07-04)
    PX domains are found in a variety of proteins that associate with cell membranes, but their molecular function has remained obscure. We show here that the PX domains in p47phox and p40phox subunits of the phagocyte NADPH oxidase bind to
    Futoshi Kuribayashi et al.
    The EMBO journal, 21(23), 6312-6320 (2002-11-29)
    Activation of the superoxide-producing phagocyte NADPH oxidase, crucial in host defense, requires the cytosolic proteins p67(phox) and p47(phox). They translocate to the membrane upon cell stimulation and activate flavocytochrome b(558), the membrane-integrated catalytic core of this enzyme system. The activators

    Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

    Contact Technical Service