Saltar al contenido
Merck

HPA012828

Sigma-Aldrich

Anti-MAP2 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-MAP 2, Anti-MAP-2, Anti-Microtubule-associated protein 2

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

immunogen sequence

EAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQTAALPLAAEETANLPPSPPPSPASEQTVT

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MAP2(4133)

General description

MAP2 gene is located at 2q34 on the human chromosome.
Microtubule-associated protein 2 (MAP2) is a major cytoskeletal protein in neurons belonging to a family of heat stable microtubule-associated proteins. It has 11 conserved PXXP motifs that are ligands for Src homology 3 (SH3) domains. MAP2 contains a microtubule-binding domain (MTBD) near the carboxyl terminus of the molecule.

Immunogen

Microtubule-associated protein 2 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-MAP2 antibody produced in rabbit has been used in immunofluorescence and immunohistochemistry.
Anti-MAP2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

Microtubule-associated protein 2 (MAP2) is majorly involved in maintaining cellular structural integrity, microtubule assembly and stability by interacting with the carboxy-terminal of tubulin and linking other cytoskeletal polymers to it. It acts like a molecular scaffold upon which cytoskeleton-modifying proteins assemble, interact and dissociate in response to neuronal activity. Many proteins like type II regulatory subunit of protein kinase A ( PKA), F-actin, calmodulin and the mitochondrial outer membrane protein porin have been shown to interact with MAP2. Tyrosine kinase FYN binds with and phosphorylates MAP2. This phosphorylation further helps in binding of the Src homology 2 (SH2) domain of growth factor receptor-bound protein 2 (GRB2) to MAP2. In this way, a number of signaling proteins are recruited by it for the pathways involved in central nervous system development.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71545

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Optional

Referencia del producto
Descripción
Precios

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Los clientes también vieron

Depletion of MAP2 expression and laminar cytoarchitectonic changes in dorsolateral prefrontal cortex in adult autistic individuals
Mukaetova L E B, et al.
Neuropathology and Applied Neurobiology, 30(6), 615-623 (2004)
A radial glia fascicle leads principal neurons from the pallial-subpallial boundary into the developing human insula
Gonzalez A E, et al.
Frontiers in Neuroanatomy, 11(3), 111-111 (2017)
R B Maccioni et al.
Physiological reviews, 75(4), 835-864 (1995-10-01)
In eukaryotic cells, microtubules, actin, and intermediate filaments interact to form the cytoskeletal network involved in determination of cell architecture, intracellular transport, modulation of surface receptors, mitosis, cell motility, and differentiation. Cytoskeletal organization and dynamics depend on protein self-associations and
S Pilar Zamora-Leon et al.
The Journal of biological chemistry, 280(3), 1962-1970 (2004-11-13)
The Src homology 3 (SH3) domain of Fyn binds to a conserved PXXP motif on microtubule-associated protein-2. Co-transfections into COS7 cells and in vitro kinase assays performed with Fyn and wild-type, or mutant MAP-2c, determined that Fyn phosphorylated MAP-2c on
Lijun Ye et al.
Advanced materials (Deerfield Beach, Fla.), 33(41), e2102981-e2102981 (2021-08-29)
It is often assumed that carbon nanotubes (CNTs) stimulate neuronal differentiation by transferring electrical signals and enhancing neuronal excitability. Given this, CNT-hydrogel composites are regarded as potential materials able to combine high electrical conductivity with biocompatibility, and therefore promote nerve

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico