Accéder au contenu
Merck
Toutes les photos(11)

Key Documents

WH0009804M1

Sigma-Aldrich

Monoclonal Anti-TOMM20 antibody produced in mouse

clone 4F3, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-KIAA0016, Anti-MAS20, Anti-MGC117367, Anti-MOM19, Anti-TOM20, Anti-translocase of outer mitochondrial membrane 20 homolog (yeast)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(11)

About This Item

Numéro MDL:
MFCD04118702
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

4F3, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human, mouse, rat

Technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotype

IgG1κ

Numéro d'accès GenBank

BC066335

Numéro d'accès UniProt

Q15388

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TOMM20(9804)

Catégories apparentées

Description générale

Translocase of outer mitochondrial membrane 20 (TOMM20) is a 20kb gene with five exons and four introns, and is mapped to human chromosome 1q42.3. This gene codes for a TOMM20 receptor, which is a subunit of the outer mitochondrial membrane translocase. TOMM20 receptor contains a membrane anchor domain and a cytosolic domain, and is predominantly expressed in human cochlea.

Immunogène

TOMM20 (AAH66335, 1 a.a. ~ 145 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE

Actions biochimiques/physiologiques

Translocase of outer mitochondrial membrane 20 (TOMM20) is a subunit of multiple component- dynamic complex, which plays a vital role in importing certain cytosolic proteins into or through the outer membrane of the mitochondria. It acts as a receptor for precursor proteins containing N-terminal cleavable presequences targeted to the mitochondria. Nuclear respiratory factor 2(NRF-2) plays an essential role in regulating transcription of the human TOMM20 gene. TOMM20 has potential as a prognostic biomarker and therapeutic target for gastric cancer. TOMM20 serve as a marker for mitochondrial protein import in inner ear, and reduced expression of TOMM20 is associated with Meniere′s disease.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

En option

Réf. du produit
Description
Tarif

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Sinem K Saka et al.
Nature communications, 5, 3664-3664 (2014-04-11)
The isotopic composition of different materials can be imaged by secondary ion mass spectrometry. In biology, this method is mainly used to study cellular metabolism and turnover, by pulsing the cells with marker molecules such as amino acids labelled with
Z Zhao et al.
European journal of surgical oncology : the journal of the European Society of Surgical Oncology and the British Association of Surgical Oncology, 40(10), 1361-1368 (2014-05-14)
To explore metabolic symbiosis in gastric cancer and its relationship with cancer prognosis. Immunohistochemistry was used to detect MCT4 and TOMM20 expression in 113 gastric cancer patient specimens. The correlations of MCT4 and TOMM20 expression with gastric cancer clinicopathological features
Paola Agüi-Gonzalez et al.
Nanomaterials (Basel, Switzerland), 11(7) (2021-08-08)
Nanoscale imaging with the ability to identify cellular organelles and protein complexes has been a highly challenging subject in the secondary ion mass spectrometry (SIMS) of biological samples. This is because only a few isotopic tags can be used successfully
Sebastián A Riquelme et al.
European journal of immunology, 45(12), 3269-3288 (2015-10-16)
Heme-oxygenase 1 (HO-1) prevents T cell-mediated inflammatory disease by producing carbon monoxide (CO) and impairing DC immunogenicity. However, the cellular mechanisms causing this inhibition are unknown. Here, we show that CO impairs mitochondrial function in DCs by reducing both the
José R Blesa et al.
Gene, 391(1-2), 198-208 (2007-02-16)
TOMM20 is a subunit of the outer mitochondrial membrane translocase that plays a major role as a receptor of precursor proteins with N-terminal cleavable presequences targeted to the mitochondria. Nuclear respiratory factors 1 and 2 (NRF-1 and NRF-2) play an
Afficher tous les articles scientifiques apparentés

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique