Accéder au contenu
Merck
Toutes les photos(7)

Key Documents

WH0007150M1

Sigma-Aldrich

Monoclonal Anti-TOP1 antibody produced in mouse

clone 1A1, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-TOPI, Anti-topoisomerase (DNA) I

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(7)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

1A1, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

ELISA: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 1-5 μg/mL

Isotype

IgG1κ

Numéro d'accès GenBank

NM_003286

Numéro d'accès UniProt

P11387

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TOP1(7150)

Description générale

The gene TOP1 (DNA topoisomerase 1) is mapped to human chromosome 20q12-q13.1. The protein localizes in the nucleus.

Immunogène

TOP1 (NP_003277, 692 a.a. ~ 765 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF

Actions biochimiques/physiologiques

DNA topoisomerases cause single (type-1) or double (type-2) strand DNA breaks, leading to DNA relaxation. They control DNA replication, transcription, recombination and chromatin remodeling. TOP1 (DNA topoisomerase 1) binds to the promoters and thereby induces nucleosome disassembly, histone acetylation and gene expression. Camptothecin is a non-competitive TOP1 inhibitor. TOP1 also controls alternative splicing through phosphorylation of serine/arginine-rich proteins. It is up-regulated in non-small cell lung cancer (NSCLC).

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Rhythmic binding of Topoisomerase I impacts on the transcription of Bmal1 and circadian period.
Yoshiaki Onishi
Nucleic Acids Research, 40 (2012)
Salim Khiati et al.
Molecular pharmacology, 86(2), 193-199 (2014-06-04)
Lamellarin D (Lam-D) is a hexacyclic pyrole alkaloid isolated from marine invertebrates, whose biologic properties have been attributed to mitochondrial targeting. Mitochondria contain their own DNA (mtDNA), and the only specific mitochondrial topoisomerase in vertebrates is mitochondrial topoisomerase I (Top1mt).
Elevated expression levels of NCOA3, TOP1, and TFAP2C in breast tumors as predictors of poor prognosis
Chen Zhao
Cancer, 98 (2003)
Correlation between topoisomerase I and tyrosyl-DNA phosphodiesterase 1 activities in non-small cell lung cancer tissue
Ann-Katrine Jakobsen
Experimental and Molecular Pathology, 99 (2015)
Sumoylation of topoisomerase I is involved in its partitioning between nucleoli and nucleoplasm and its clearing from nucleoli in response to camptothecin
Prasad Rallabhandi
The Journal of Biological Chemistry, 27 (2002)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique