SAB5702271

Anti-TCF1/TCF7 Antibody, clone 4K0X6, Rabbit Monoclonal

• Synonyme(s) : TCF7,TCF-1
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 4K0X6, monoclonal
• Forme: liquid
• Poids mol.: 28-50 kDa
• Espèces réactives: human, rat, rat
• Concentration: 1.00 mg/mL
• Technique(s): western blot: 1:500 - 1:1000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: ELKSSLVNESEGAAGGAGIPGVPGAGAGARGEAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGMYKETVYSAFNLLMHYPPPSGAGQHPQPQPPLHKA
• Numéro d'accès UniProt: P36402
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... TCF7(6932)

Description

Description générale

The protein encoded by this gene is a transcriptional activator that plays an important role in lymphocyte differentiation. This gene is expressed predominantly in T-cells. The encoded protein can bind an enhancer element and activate the CD3E gene, and it also may repress the CTNNB1 and TCF7L2 genes through a feedback mechanism. Several transcript variants encoding different isoforms have been found for this gene.

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TCF1/TCF7 (NP_003193.2).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Informations sur la sécurité

• Pictogrammes: GHS07,GHS09
• Mention d'avertissement: Warning
• Mentions de danger: H317,H411
• Conseils de prudence: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Classification des risques: Aquatic Chronic 2 - Skin Sens. 1
• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3