HPA021501

Anti-DUSP19 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-Dual specificity protein phosphatase 19, Anti-Dual-specificity phosphatase TS-DSP1, Anti-LMW-DSP3, Anti-Protein phosphatase SKRP1, Anti-SAPK pathway-regulating phosphatase 1, Anti-Stress-activated protein kinase pathway-regulating phosphatase 1
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA021501
• Nomenclature NACRES : NA.43

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: recombinant expression; Learn more about Antibody Enhanced Validation
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• Séquence immunogène: QEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGGGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTL
• Numéro d'accès UniProt: Q8WTR2
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... DUSP19(142679)

Description

Description générale

Dual specificity protein phosphatase 19 (DUSP19) belongs to the family of mitogen-activated protein kinase phosphatases (MKPs). The catalytic site on phosphatase domain of protein contains aspartic acid, cysteine, and arginine residues. The protein structure also contains N-terminal region made up of two CDC25 homology-2 domains and MAP kinase-binding (MKB) motif or kinase-interacting motif (KIM) which helps in enzyme-substrate interaction. DUSP19 gene is mapped to human chromosome 2.

Immunogène

Dual specificity protein phosphatase 19 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Actions biochimiques/physiologiques

Dual specificity protein phosphatase 19 (DUSP19) is a member of DUSP (dual specificity protein phosphatase) family. Primary function of this protein family is to dephosphorylate both tyrosine and serine/threonine residues of their substrates, and thus function as inactivators of MAPK (mitogen activated kinases). DUSP19 plays a vital role in inhibiting apoptosis of cartilage cells by dephosphorylating JNK (c-Jun N-terminal kinase).

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST73642

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable