HPA008422

Anti-NFKB2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonyme(s) : Anti-DNA-binding factor KBF2, Anti-H2TF1, Anti-Lymphocyte translocation chromosome 10, Anti-Lyt10, Anti-Nuclear factor NF-kappa-B p100 subunit, Anti-Oncogene Lyt-10
• Numéro MDL: MFCD01322455
• Code UNSPSC : 12352203
• Numéro HPA (Human Protein Atlas): HPA008422
• Nomenclature NACRES : NA.43

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Gamme de produits: Prestige Antibodies^® Powered by Atlas Antibodies
• Forme: buffered aqueous glycerol solution
• Espèces réactives: human
• Validation améliorée: orthogonal RNAseq; RNAi knockdown; independent; Learn more about Antibody Enhanced Validation
• Technique(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• Séquence immunogène: LLNAAQNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGLRSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGPETRDKLPSTEVKEDSAYGSQSVEQEA
• Numéro d'accès UniProt: Q00653
• Application(s): research pathology
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... NFKB2(4791)

Description

Description générale

Nuclear factor NF-κ-B p100 subunit (NFKB2) is a transcription factor which belongs to the NF-kappa B/Rel family of proteins.

Immunogène

Nuclear factor NF-kappa-B p100 subunit recombinant protein epitope signature tag (PrEST)

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Actions biochimiques/physiologiques

Nuclear factor NF-κ-B p100 subunit (NFKB2) is at the endpoint of many of signal transduction pathways which are initiated by stimuli such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. It forms a homo- or heterodimeric complex with proteins. These complexes bind at κ-B sites in the DNA of their target genes. NFKB2 complexes are present in the cytoplasm in an inactive state bound to the NF-κ-B inhibitors. For the activation of NFKB2, I-κ-B (inhibitor) is phosphorylated by I-κ-B kinases (IKKs) and degraded. Thus the active NF-κ-B complex is free from the inhibitor and can translocate to the nucleus. NFKB2 plays an important role in the cytoplasmic retention of attached NFKB2 proteins by p100 and the generation of p52 by cotranslational processing. It also regulates the circadian clock by repressing the transcriptional activator activity of the complex formed by aryl hydrocarbon receptor nuclear translocator-like protein 1 (ARNTL) with other proteins.

Caractéristiques et avantages

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST86729

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable
• Équipement de protection individuelle: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)