Accéder au contenu
Merck
Toutes les photos(2)

Principaux documents

HPA005434

Sigma-Aldrich

Anti-STAB1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-FEEL-1 antibody produced in rabbit, Anti-Fasciclin, EGF-like, laminin-type EGF-like and link domain-containing scavenger receptor 1 antibody produced in rabbit, Anti-MS-1 antigen antibody produced in rabbit, Anti-Stabilin-1 precursor antibody produced in rabbit

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Technique(s)

immunohistochemistry: 1:200- 1:500

Séquence immunogène

LEYKELKGDGPFTIFVPHADLMSNLSQDELARIRAHRQLVFRYHVVGCRRLRSEDLLEQGYATALSGHPLRFSEREGSIYLNDFARVVSSDHEAVNGILH

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... STAB1(23166)

Description générale

Stabilin-1(STAB1) or common lymphatic endothelial and vascular endothelial receptor-1 (CLEVER-1) is a large, multidomain, type I transmembrane protein. It is expressed in cardiac and skeletal muscle; by macrophages in skin, gut, placenta, and pancreas; and in liver, spleen, bone marrow, and lymph nodes by sinusoidal endothelial cells. Also known as FEEL-1, it contains a proteoglycan-link protein-like sequence, 7 fasciclin domains, 2 RGD (Arg-Gly-Asp ) motifs, and 22 epidermal growth factor-like repeats.

Immunogène

Stabilin-1 precursor recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Actions biochimiques/physiologiques

Stabilin-1(STAB1) or common lymphatic endothelial and vascular endothelial receptor-1 (CLEVER-1) helps in leukocyte adhesion and migration as well as regulation of angiogenesis. In human macrophages, it is responsible for trafficking between trans-Golgi network and early/sorting endosomes. In macrophages and endothelial cells, it mediates endocytosis by acting as an endocytic receptor. Stabilin-1 also acts as a receptor for acetylated low density lipoprotein (Ac-LDL), placental lactogen, SPARC protein, apoptotic bodies and bacteria, and thus is responsible for the scavenging action of macrophages. It is also responsible for the intracellular sorting of chitinase-like protein SI-CLP, which is endogenous in nature. Recent studies suggest that CLEVER-1 mediates metastasis of breast cancer and head and neck squamous cell carcinoma via the lymphatic system. Stabilin-1 is used as a marker for the diagnosis of cutaneous non-Langerhans cell histiocytoses.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST70108

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Heikki Irjala et al.
Cancer research, 63(15), 4671-4676 (2003-08-09)
Although approximately 50% of cancers give rise to metastases via the lymphatic system, the mechanisms mediating this process have remained unknown. In this study, we have investigated the role of two lymphatic endothelial molecules, the mannose receptor (MR) and common
Shishir Shetty et al.
Journal of immunology (Baltimore, Md. : 1950), 186(7), 4147-4155 (2011-03-04)
The common lymphatic endothelial and vascular endothelial receptor (CLEVER-1; also known as FEEL-1 and stabilin-1) is a recycling and intracellular trafficking receptor with multifunctional properties. In this study, we demonstrate increased endothelial expression of CLEVER-1/stabilin-1 at sites of leukocyte recruitment
Julia Kzhyshkowska
TheScientificWorldJournal, 10, 2039-2053 (2010-10-19)
The multifunctional scavenger receptor stabilin-1 (STAB1, FEEL-1, CLEVER-1, KIAA0246) is expressed on tissue macrophages and sinusoidal endothelial cells in healthy organisms, and its expression on both macrophages and different subtypes of endothelial cells is induced during chronic inflammation and tumor
Julia Kzhyshkowska et al.
Journal of leukocyte biology, 76(6), 1151-1161 (2004-09-04)
Stabilin-1 and stabilin-2 constitute a novel family of fasciclin domain-containing hyaluronan receptor homologues recently described by us. Whereas stabilin-1 is expressed in sinusoidal endothelial cells and in macrophages in vivo, stabilin-2 is absent from the latter. In the present study
Senthil Palani et al.
European journal of immunology, 41(7), 2052-2063 (2011-04-12)
Stabilin-1/common lymphatic endothelial and vascular endothelial receptor-1 (CLEVER-1) is a multidomain protein present in lymphatic and vascular endothelial cells and type 2 immunosuppressive macrophages. In adults, stabilin-1/CLEVER-1 is a scavenging receptor and an adhesion molecule, but much less is known

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique