AV49523
Anti-IL22 antibody produced in rabbit
affinity isolated antibody
Synonyme(s) :
Anti-IL-21, Anti-IL-22, Anti-IL-D110, Anti-IL-TIF, Anti-IL21, Anti-ILTIF, Anti-Interleukin 22, Anti-MGC79382
Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
About This Item
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41
Produits recommandés
Source biologique
rabbit
Niveau de qualité
Conjugué
unconjugated
Forme d'anticorps
affinity isolated antibody
Type de produit anticorps
primary antibodies
Clone
polyclonal
Forme
buffered aqueous solution
Poids mol.
20 kDa
Espèces réactives
rat, mouse, human
Concentration
0.5 mg - 1 mg/mL
Technique(s)
western blot: suitable
Numéro d'accès NCBI
Numéro d'accès UniProt
Conditions d'expédition
wet ice
Température de stockage
−20°C
Modification post-traductionnelle de la cible
unmodified
Informations sur le gène
human ... IL22(50616)
Catégories apparentées
Description générale
Interleukin 22 (IL-22) belongs to the IL10 family of T-cell associated cytokines, highly expressed in αβ and γδ T cells, as well as in innate lymphoid cells. Inflammatory cells associated with the thymus, pancreas, synovium, skin, and gut secrete IL-22. The Il-22 gene is localized on human chromosome 12q15.
Immunogène
Synthetic peptide directed towards the C terminal region of human IL22
Application
Anti-IL22 antibody produced in rabbit has been used in immunoblotting (1:1000).
Actions biochimiques/physiologiques
Interleukin 22 (IL-22) plays a key role in cell proliferation, cellular defense, and tissue regeneration, It shows potential in wound healing and to treat gastrointestinal (GI)-related illnesses. Higher levels of IL-22 is observed in systemic lupus erythematosus, vitiligo, multiple sclerosis, etc.
Interleukin 22 (IL22) belongs to the interleukin 10 (IL-10) family. It is a cytokine that contributes to the inflammatory response in vivo. IL22 cellular effects are mediated by a heterodimeric receptor made up of IL22 and IL-10Rβ. IL22 signaling mediates proliferation of epithelial cells during inflammation mainly by the activation of signal transducer and activator of transcription 1 (STAT1) and STAT3 signaling.
Séquence
Synthetic peptide located within the following region: CHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
Forme physique
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clause de non-responsabilité
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Vous ne trouvez pas le bon produit ?
Essayez notre Outil de sélection de produits.
Code de la classe de stockage
10 - Combustible liquids
Classe de danger pour l'eau (WGK)
WGK 3
Point d'éclair (°F)
Not applicable
Point d'éclair (°C)
Not applicable
Certificats d'analyse (COA)
Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".
Déjà en possession de ce produit ?
Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.
Olivia B Parks et al.
Frontiers in cell and developmental biology, 3, 85-85 (2016-01-23)
Interleukin (IL)-22 is a member of the IL-10 family of cytokines that has been extensively studied since its discovery in 2000. This review article aims to describe the cellular sources and signaling pathways of this cytokine as well as the
Kerstin Wolk et al.
European journal of immunology, 36(5), 1309-1323 (2006-04-19)
IL-22 is an IFN-IL-10 cytokine family member, which is produced by activated Th1 and NK cells and acts primarily on epithelial cells. Here we demonstrate that IL-22, in contrast to its relative IFN-gamma, regulates the expression of only a few
Lauren A Zenewicz
ImmunoHorizons, 2(6), 198-207 (2019-04-26)
IL-22 is a critical cytokine in modulating tissue responses during inflammation. IL-22 is upregulated in many chronic inflammatory diseases, making IL-22 biology a potentially rewarding therapeutic target. However, this is complicated by the dual-natured role of IL-22 in inflammation, as
Jane A Lindborg et al.
Cell reports, 34(9), 108777-108777 (2021-03-04)
Adult mammalian central nervous system (CNS) trauma interrupts neural networks and, because axonal regeneration is minimal, neurological deficits persist. Repair via axonal growth is limited by extracellular inhibitors and cell-autonomous factors. Based on results from a screen in vitro, we evaluate
Lauren A Zenewicz et al.
European journal of immunology, 38(12), 3265-3268 (2008-11-20)
IL-22 is a Th17 T-cell-associated cytokine that is highly expressed during chronic inflammation. IL-22 receptor expression is absent on immune cells, but is instead restricted to the tissues, providing signaling directionality from the immune system to the tissues. Through Stat3
Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..
Contacter notre Service technique