Accéder au contenu
Merck
Toutes les photos(3)

Key Documents

AV44268

Sigma-Aldrich

Anti-TGFBI antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-BIGH3, Anti-CDB1, Anti-CDG2, Anti-CDGG1, Anti-CSD, Anti-CSD1, Anti-CSD2, Anti-Transforming growth factor, β-induced, 68 kDa

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(3)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

46 kDa

Espèces réactives

horse, human, guinea pig, mouse, bovine, rabbit

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunofluorescence: suitable
western blot: suitable

Numéro d'accès NCBI

NP_000349

Numéro d'accès UniProt

Q15582

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TGFBI(7045)

Description générale

Transforming growth factor, β-induced, 68 kDa (TGFB1, BIGH3, CDB1, CDG2, CDGG1, CSD) is a cell signaling protein with a wide range of functions, mostly as a negative/suppressive modulator of cell growth. TGFB1 is a modulator of immune function and an inducer of cell transformation. The actions of TGFB1 are mediated via transforming growth factor β receptors.

Spécificité

Anti-TGFBI polyclonal antibody reacts with chicken, human, mouse, rat, bovine, pig, and rabbit transforming growth factor, β 1 proteins.

Immunogène

Synthetic peptide directed towards the C terminal region of human TGFBI

Application

Anti-TGFBI polyclonal antibody is used to tag transforming growth factor, β 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of transforming growth factor, β 1 in cell signaling within a wide range of cell types.

Actions biochimiques/physiologiques

TGFBI Binds to type I, II, and IV collagens. This adhesion protein may play an important role in cell-collagen interactions. In cartilage, may be involved in endochondral bone formation.

Séquence

Synthetic peptide located within the following region: LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Yu-Ping Han et al.
Current eye research, 37(11), 990-996 (2012-07-04)
Types 1 and 2 granular corneal dystrophies (GCD) are primarily associated with accumulation of the R555W and R124H mutant transforming growth factor β-inducible proteins (TGFBIp) in corneal stroma, respectively. However, specific components of TGFBIp responsible for granular deposits have not
Sergio Sastriques-Dunlop et al.
Scientific reports, 14(1), 1438-1438 (2024-01-17)
Abdominal aortic aneurysms (AAAs) are prevalent with aging, and AAA rupture is associated with increased mortality. There is currently no effective medical therapy to prevent AAA rupture. The monocyte chemoattractant protein (MCP-1)/C-C chemokine receptor type 2 (CCR2) axis critically regulates

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique