Accéder au contenu
Merck
Toutes les photos(4)

Principaux documents

SAB2108448

Sigma-Aldrich

Anti-PCNA

IgG fraction of antiserum

Synonyme(s) :

Anti-AIT

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme

Sélectionner une taille de conditionnement

100 μL
383,00 €

383,00 €


Check Cart for Availability


Sélectionner une taille de conditionnement

Changer de vue
100 μL
383,00 €

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

383,00 €


Check Cart for Availability

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

29 kDa

Espèces réactives

bovine, rat, dog, mouse, human

Concentration

0.5-1 mg/mL

Technique(s)

immunoblotting: suitable
immunohistochemistry: suitable

Numéro d'accès

NM_002592

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PCNA(5111)

Description générale

Proliferating cell nuclear antigen (PCNA), a nuclear protein, is expressed ubiquitously in mammals. This homotrimer protein is a doughnut-shaped molecule that is expressed at high levels in the thymus, bone marrow, fetal liver, and few cells of the small intestine and colon. PCNA is mainly located in the nucleus. The PCNA gene is a single-copy gene mapped to human chromosome 20p13.

Immunogène

Synthetic peptide directed towards the C terminal region of human PCNA

Application

Anti-PCNA has been used in:
  • immunoblot (1:500)[1][2] (1:1,000)[3] (1:750)[4]
  • far-western analysis (1:1000)[5]
  • immunohistochemistry (1?:?50)[2] (1:1000)[6]
  • proliferating cell nuclear antigen (PCNA) overlay assay (1:1,000)[4]

Actions biochimiques/physiologiques

Proliferating cell nuclear antigen (PCNA) participates in DNA replication and repair. It acts as an auxiliary factor of polymerase δ. It plays a key role in the maturation of Okazaki fragments. It can be used as a prognostic and diagnostic marker in chronic lymphoid leukemia (CLL). High expression of PCNA protein is seen in breast and duodenal cancers.

Séquence

Synthetic peptide located within the following region: LNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Elsayed I Salim et al.
Asian Pacific journal of cancer prevention : APJCP, 17(3), 1023-1035 (2016-04-05)
The purpose of this study was to investigate the role of colon cancer stem cells (CSCs) during chemicallyinduced rat multi-step colon carcinogenesis with or without the treatment with a specific cyclooxygenase-2 inhibitor drug (celecoxib). Two experiments were performed, the first
Amaia González-Magaña et al.
Biomolecules, 10(4) (2020-04-12)
: Proliferating cell nuclear antigen (PCNA) is an essential factor in DNA replication and repair. It forms a homotrimeric ring that embraces the DNA and slides along it, anchoring DNA polymerases and other DNA editing enzymes. It also interacts with
Xiaolan Ye et al.
Medicine, 99(16), e19755-e19755 (2020-04-22)
Although proliferating cell nuclear antigen (PCNA) plays an important role in tumor proliferation and its expression level is closely related to the biological activity of tumor cells, PCNA expression in non-small cell lung cancer (NSCLC) has been seldom reported. In
Gang Li et al.
Journal of cellular physiology (2019-02-26)
Renal cell carcinoma (RCC) is a common urinary system cancer with high morbidity and mortality rate. Clear cell renal cell carcinoma (ccRCC) is a highly aggressive and common type of RCC. More and effective therapeutic targets are badly needed for
Elsayed I Salim et al.
Asian Pacific journal of cancer prevention : APJCP, 21(9), 2739-2750 (2020-09-29)
In search for a unique natural combination of highly active biological components for treatment against colon cancer, we used aqueous extract of Ascidia, Styela plicata (ASCex), a marine invertebrate depending on its richness of high levels of biologically active components

Questions

Évaluations

Aucune valeur de notation

Filtres actifs

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique