Accéder au contenu
Merck
Toutes les photos(2)

Key Documents

SAB1408646

Sigma-Aldrich

Anti-RAB7L1 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

DKFZp686P1051, RAB7L

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

antigen ~23.2 kDa

Espèces réactives

mouse, human

Technique(s)

western blot: 1 μg/mL

Numéro d'accès NCBI

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... RAB7L1(8934)

Description générale

RAB7L1 (Rab-7-like protein 1, also referred to as RAB29) is a cytosolic GTPase. The gene encoding it is localized on human chromosome 1q32. Rabbit polyclonal antibody raised against a full-length human RAB7L1 protein.

Immunogène

RAB7L1 (NP_003920.1, 1 a.a. ~ 203 a.a) full-length human protein.

Sequence
MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC

Actions biochimiques/physiologiques

RAB7L1 (Rab-7-like protein 1, also referred to as RAB29) modulates protein transport from the Golgi apparatus to lysosomes. It also modulates phagocytosis. RAB7L1 has been associated with Parkinson′s disease.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Certificats d'analyse (COA)

Recherchez un Certificats d'analyse (COA) en saisissant le numéro de lot du produit. Les numéros de lot figurent sur l'étiquette du produit après les mots "Lot" ou "Batch".

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

X-Y Guo et al.
European journal of neurology, 21(10), 1337-1343 (2014-07-22)
Recently, the rs1572931 single-nucleotide polymorphism (SNP) of the putative promoter of the member RAS oncogene family-like 1 (RAB7L1) gene was reported to be associated with reduced risk for Parkinson's disease (PD) in the Ashkenazi Jewish population. Ethnic-specific effects are an
Shicong Wang et al.
PloS one, 9(5), e96242-e96242 (2014-05-03)
Rab29 (also referred as Rab7L1) is a novel Rab protein, and is recently demonstrated to regulate phagocytosis and traffic from the Golgi to the lysosome. However, its roles in membrane trafficking have not been investigated extensively. Our results in this
David A MacLeod et al.
Neuron, 77(3), 425-439 (2013-02-12)
Recent genome-wide association studies have linked common variants in the human genome to Parkinson's disease (PD) risk. Here we show that the consequences of variants at 2 such loci, PARK16 and LRRK2, are highly interrelated, both in terms of their

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique