Skip to Content
Merck
All Photos(1)

Key Documents

AV34976

Sigma-Aldrich

Anti-GABRA1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-γ-Aminobutyric acid (GABA) A receptor, α 1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

52 kDa

species reactivity

rabbit, bovine, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... GABRA1(2554)

General description

GABRA1 codes for an alpha subunit of the gamma-aminobutyric acid (GABA) A receptor. Genetic alterations in GABRA1 have been linked to juvenile myoclonic epilepsy, bipolar disorders and Dravet syndrome.
Rabbit Anti-GABRA1 antibody recognizes canine, bovine, human, mouse, and rat GABRA1.

Immunogen

Synthetic peptide directed towards the N terminal region of human GABRA1

Application

Rabbit Anti-GABRA1 antibody is suitable for western blot applications at 0.5 μg/ml.

Biochem/physiol Actions

GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.

Sequence

Synthetic peptide located within the following region: WAWILLLSTLTGRSYGQPSLQDELKDNTTVFTRILDRLLDGYDNRLRPGL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Patrick Cossette et al.
Nature genetics, 31(2), 184-189 (2002-05-07)
Although many genes that predispose for epilepsy in humans have been determined, those that underlie the classical syndromes of idiopathic generalized epilepsy (IGE) have yet to be identified. We report that an Ala322Asp mutation in GABRA1, encoding the alpha1 subunit
Yasue Horiuchi et al.
Biological psychiatry, 55(1), 40-45 (2004-01-07)
The gamma-aminobutyric acid (GABA) neurotransmitter system has been implicated in the pathogenesis of mood disorders. The GABRA1 gene encodes one of the subunits of GABA-A receptor and is located on human chromosome 5q34-q35, which is a region reportedly linked to
Gemma L Carvill et al.
Neurology, 82(14), 1245-1253 (2014-03-14)
To determine the genes underlying Dravet syndrome in patients who do not have an SCN1A mutation on routine testing. We performed whole-exome sequencing in 13 SCN1A-negative patients with Dravet syndrome and targeted resequencing in 67 additional patients to identify new

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service