Saltar al contenido
Merck
Todas las fotos(5)

Documentos clave

WH0010413M1

Sigma-Aldrich

Monoclonal Anti-YAP1 antibody produced in mouse

clone 2F12, purified immunoglobulin, buffered aqueous solution

Sinónimos:

Anti-YAP, Anti-YAP2, Anti-YAP65, Anti-Yes-associated protein 1, 65kDa

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Número MDL:
Código UNSPSC:
12352203
NACRES:
NA.41
conjugado:
unconjugated
application:
ELISA
IF
IHC (p)
WB
clon:
2F12, monoclonal
reactividad de especies:
human
citations:
43
técnicas:
ELISA: suitable
immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 1-5 μg/mL

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

2F12, monoclonal

Formulario

buffered aqueous solution

reactividad de especies

human

técnicas

ELISA: suitable
immunofluorescence: suitable
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso GenBank

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... YAP1(10413)

Descripción general

This gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. This protein contains a WW domain that is found in various structural, regulatory and signaling molecules in yeast, nematode, and mammals, and may be involved in protein-protein interaction. (provided by RefSeq)
Yes-associated protein 1 (YAP1) is a transcriptional coactivator. It possesses two WW domains, a TID domain (TEA domain family member 1 transcription factor interacting-domain), sarcoma homology 3 domain (SH3) binding motif, a proline rich region and a PDZ motif. It is expressed in eight isoforms. The YAP1 gene is localized on human chromosome 11q22.1.

Inmunógeno

YAP1 (NP_006097, 53 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR

Aplicación

Monoclonal Anti-YAP1 antibody produced in mouse has been used in western blotting and co-immunoprecipitation.

Acciones bioquímicas o fisiológicas

Yes-associated protein 1 (YAP1) promotes cell and tissue growth. It interacts with receptor tyrosine-protein kinase (ErbB4) receptor and regulates transcription. YAP1 is an oncogenic protein and contributes to tumor progression. It is highly expressed in hedgehog-associated medulloblastomas and mutations in YAP1 is also implicated in optic fissure closure defects. Knockdown of YAP1 gene has been shown to lead to apoptosis of prostate cancer cells and is considered as a potential target for treatment.

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

WW domain-containing protein YAP associates with ErbB-4 and acts as a co-transcriptional activator for the carboxy-terminal fragment of ErbB-4 that translocates to the nucleus.
Komuro A, et al.
The Journal of Biological Chemistry, 22(14), 1962-1971 (2003)
Tumor suppressor Nf2 limits expansion of the neural progenitor pool by inhibiting Yap/Taz transcriptional coactivators.
Lavado A, et al.
Development, 6(1), 096537-096537 (2013)
Amot regulates neuronal dendritic tree through Yap1.
Rojek K, et al.
bioRxiv, 6(1), 345264-345264 (2018)
YAP promotes osteogenesis and suppresses adipogenic differentiation by regulating beta-catenin signaling.
Pan Jin-Xiu, et al.
Bone research, 6(1), 18-18 (2018)
Kai Zhao et al.
The Journal of neuroscience : the official journal of the Society for Neuroscience, 37(13), 3465-3477 (2017-02-19)
Yes-associated protein (Yap) is a major effector of the Hippo pathway that regulates cell proliferation and differentiation during development and restricts tissue growth in adult animals. However, its role in synapse formation remains poorly understood. In this study, we characterized

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico