WH0008543M1

Monoclonal Anti-LMO4 antibody produced in mouse

clone 4H8, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-LIM domain only 4
• Número MDL: MFCD03096993
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 4H8, monoclonal
• formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2aλ
• Nº de acceso GenBank: BC017673
• Nº de acceso UniProt: P61968
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... LMO4(8543)

Descripción

Descripción general

This gene encodes a cysteine-rich protein that contains two LIM domains but lacks a DNA-binding homeodomain. The encoded protein may play a role as a transcriptional regulator or as an oncogene. (provided by RefSeq)

Inmunógeno

LMO4 (AAH17673, 1 a.a. ~ 165 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MVNPGSSSQPPPVTAGSLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHLNSLQSNPLLPDQKVC

Forma física

Solution in phosphate buffered saline, pH 7.4

Información legal

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)