SAE0105

MT1 (Melatonin Receptor 1)

• NACRES: NA.26
• UNSPSC Code: 12352202
• Form: aqueous solution
• Assay: ≥90% (SDS-PAGE)
• Recombinant: expressed in Sf9 cells
• Mol wt: 44.8 kDa

Propiedades

• recombinant: expressed in Sf9 cells
• description: N-Terminal contains a strep tag II and 10X Histidine tag followed by a TEV protease cleavage site.
• assay: ≥90% (SDS-PAGE)
• form: aqueous solution
• mol wt: 44.8 kDa
• concentration: 1 mg/mL
• UniProt accession no.: P48039
• shipped in: dry ice
• storage temp.: −70°C

Descripción

Biochem/physiol Actions

Melatonin receptor 1 (MT1) is a class A GPCR that modulates neuronal firing, arterial vasoconstriction, cell proliferation in cancer cells, and reproductive and metabolic functions.

Preparation Note

Formulated in 25mM Na₂HPO₄ pH 8.0, 150mM NaCl, 0.86%/0.18% Sarkosyl/CHS.

Thaw on ice. Upon first thaw, briefly spin tube containing enzyme to recover full content of the tube. Aliquot into single use aliquots. Store remaining undiluted protein in aliquots at -80°C.

Other Notes

MASAWSHPQFEKGGGSGGGSGGSAWSHPQFEKGAHHHHHHHHHHENLYFQGQGNGSALPNASQPVLRGDGARPSWLASALACVLIFTIVVDILGNLLVILSVYRNKKLRNAGNIFVVSLAVADLVVAIYPYPLVLMSIFNNGWNLGYLHCQVSGFLMGLSVIGSIFNITGIAINRYCYICHSLKYDKLYSSKNSLCYVLLIWLLTLAAVLPNLRAGTLQYDPRIYSCTFAQSVSSAYTIAVVVFHFLVPMIIVIFCYLRIWILVLQVRQRVKPDRKPKLKPQDFRNFVTMFVVFVLFAICWAPLNFIGLAVASDPASMVPRIPEWLFVASYYMAYFNSCLNAIIYGLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV

Información de seguridad

• Clase de almacenamiento: 12 - Non Combustible Liquids
• Punto de inflamación (°F): Not applicable
• Punto de inflamación (°C): Not applicable