SAE0103

A2A (Adenosine Receptor A2A)

recombinant, expressed in Sf9 cells

• NACRES: NA.26
• UNSPSC Code: 12352202
• Form: aqueous solution
• Assay: ≥90% (SDS-PAGE)
• Recombinant: expressed in Sf9 cells
• Mol wt: 47.7 kDa

Propiedades

• recombinant: expressed in Sf9 cells
• description: N-Terminal contains a strep tag II and 10X Histidine tag followed by a TEV protease cleavage site.
• assay: ≥90% (SDS-PAGE)
• form: aqueous solution
• mol wt: 47.7 kDa
• concentration: 1.72 mg/mL
• NCBI accession no.: NC_000022.11
• UniProt accession no.: P29274
• shipped in: dry ice
• storage temp.: −70°C

Descripción

Biochem/physiol Actions

A2A is a class A GPCR involved in regulating myocardial blood flow and hypertension.

Preparation Note

50mM Hepes pH 7.4, 200mM NaCl, 0.05%/0.006% DDM/CHS

Thaw on ice. Upon first thaw, briefly spin tube containing enzyme to recover full content of the tube. Aliquot into single use aliquots. Store remaining undiluted protein in aliquots at -70°C.

Other Notes

MWSHPQFEKHHHHHHHHENLYFQGPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS

Información de seguridad

• Clase de almacenamiento: 10 - Combustible liquids
• ¿Qué está pasando?: WGK 1
• Punto de inflamación (°F): Not applicable
• Punto de inflamación (°C): Not applicable