SAB2109081

Anti-APOE (N-terminal) antibody produced in rabbit

affinity isolated antibody

• Sinónimos: AD2, LDLCQ5, LPG, MGC1571
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• formulario: buffered aqueous solution
• mol peso: 34 kDa
• reactividad de especies (predicha por homología): human, zebrafish, rat, mouse
• concentración: 0.5 mg/mL
• técnicas: immunohistochemistry (formalin-fixed, paraffin-embedded sections): 4-8 μg/mL; western blot: 1 μg/mL
• Nº de acceso NCBI: NM_000041
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... APOE(57396)

Descripción

Descripción general

Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. The APOE gene is mapped to chromosome 19 in a cluster with APOC1 and APOC2. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.

Secuencia

Synthetic peptide located within the following region: LMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVC

Forma física

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 12 - Non Combustible Liquids
• Clase de riesgo para el agua (WGK): nwg