Saltar al contenido
Merck
Todas las fotos(3)

Documentos clave

SAB2108468

Sigma-Aldrich

Anti-FOXA3

affinity isolated antibody

Sinónimos:

Anti- HNF3G, Anti- TCF3G, Anti-FKHH3

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
498,00 €

498,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad


Seleccione un Tamaño

Cambiar Vistas
100 μL
498,00 €

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

498,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Formulario

buffered aqueous solution

mol peso

37 kDa

reactividad de especies

dog, guinea pig, rat, bovine, human

concentración

0.5-1 mg/mL

técnicas

immunoblotting: suitable
immunohistochemistry: suitable

nº de acceso

NM_004497

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... FOXA3(3171)

Descripción general

Forkhead box A3 (FOXA3), also known as hepatocyte nuclear factor 3 γ (HNF3γ), is encoded by the gene mapped to human chromosome 19q13.32. The encoded protein belongs to the Foxa subfamily. FOXA3 is characterized with a homologous forkhead DNA-binding domain and two transcriptional activation domains located at the N- and C-terminal.

Inmunógeno

Synthetic peptide directed towards the middle region of human FOXA3

Acciones bioquímicas o fisiológicas

Forkhead box A3 (FOXA3) plays a vital role in maintenance of cell glucose homeostasis during prolonged fast. It is also implicated in the regulation of fat mass in humans. FOXA3 inhibits innate immunity and increases the risk of susceptibility to viral infections associated with chronic lung disorders accompanied by chronic goblet cell metaplasia.

Secuencia

Synthetic peptide located within the following region: FENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSP

Forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 3

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

SnapShot: forkhead transcription factors I.
Tuteja G andKaestner KH.
Cell, 130, 1160-1160 (2007)
Analysis of variants and mutations in the human winged helix FOXA3 gene and associations with metabolic traits
Adler-Wailes DC, et al.
International journal of obesity (2005), 39, 888-892 (2015)
Casandra Walker et al.
International journal of molecular sciences, 24(2) (2023-01-22)
Perinatal exposure to endocrine disrupting chemicals (EDCs) has been shown to affect male reproductive functions. However, the effects on male reproduction of exposure to EDC mixtures at doses relevant to humans have not been fully characterized. In previous studies, we
Foxa3 (hepatocyte nuclear factor 3gamma ) is required for the regulation of hepatic GLUT2 expression and the maintenance of glucose homeostasis during a prolonged fast.
Shen W, et al.
The Journal of Biological Chemistry, 276, 42812-42817 (2001)
Foxa3 induces goblet cell metaplasia and inhibits innate antiviral immunity.
Chen G, et al.
American Journal of Respiratory and Critical Care Medicine, 189, 301-313 (2014)

Preguntas

Revisiones

Sin puntuación

Filtros activos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico