Synthetic peptide directed towards the middle region of human ZNF384
Acciones bioquímicas o fisiológicas
The specific function of this protein remains unknownThis gene contains long CAG trinucleotide repeats coding consecutive glutamine residues. The gene product may functions as a transcription factor, with a potential role in the regulation of neurodevelopment or neuroplasticity. The protein appears to bind and regulate the promoters of MMP1, MMP3, MMP7 and COL1A1. Studies in mouse suggest that nuclear matrix transcription factors (NP/NMP4) may be part of a general mechanical pathway that couples cell construction and function during extracellular matrix remodeling. Multiple transcript variants encoding several isoforms have been found for this gene.
Secuencia
Synthetic peptide located within the following region: KKKRMLESGLPEMNDPYVLSPEDDDDHQKDGKTYRCRMCSLTFYSKSEMQ
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.