Saltar al contenido
Merck
Todas las fotos(4)

Documentos clave

SAB1404011

Sigma-Aldrich

Anti-KRAS Antibody

mouse monoclonal, 4F3

Sinónimos:

C-K-RAS, K-RAS2A, K-RAS2B, K-RAS4A, K-RAS4B, KI-RAS, KRAS1, KRAS2, NS3

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μG
490,00 €

490,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad


Seleccione un Tamaño

Cambiar Vistas
100 μG
490,00 €

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

490,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad

Nombre del producto

Monoclonal Anti-KRAS antibody produced in mouse, clone 4F3, purified immunoglobulin, buffered aqueous solution

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

4F3, monoclonal

Formulario

buffered aqueous solution

mol peso

antigen ~38.21 kDa

reactividad de especies

human

técnicas

capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... KRAS(3845)

Descripción general

This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region. (provided by RefSeq)
c-K-Ras or KRAS (Kirsten rat sarcoma-2 virus oncogene) is a small GTP-binding protein. The gene encoding it is localized on human chromosome 12p12.1. KRAS has two splice variants, that is, KRASA and KRASB (KRAS proto-oncogenes). Expression of KRASA is restricted to specific tissues whereas KRASB is ubiquitously expressed.

Inmunógeno

KRAS (NP_004976, 16 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTV

Aplicación

Monoclonal Anti-KRAS antibody produced in mouse has been used in Western Blotting.[1]

Acciones bioquímicas o fisiológicas

KRAS (Kirsten rat sarcoma-2 virus oncogene) mutation has been associated with early rectal cancer and colorectal cancer. The protein has a role in signaling pathways.
KRAS (kirsten rat sarcoma-2 virus oncogene) upon binding to a cell surface receptor, including EGFR functions as a self-inactivating signal transducer by cycling from GDP- to GTP-bound states. Mutation in the gene leads to poor prognosis of early rectal cancer.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Opcional

Referencia del producto
Descripción
Precios

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

David M Briere et al.
Molecular cancer therapeutics, 20(6), 975-985 (2021-03-17)
KRASG12C inhibitors, including MRTX849, are promising treatment options for KRAS-mutant non-small cell lung cancer (NSCLC). PD-1 inhibitors are approved in NSCLC; however, strategies to enhance checkpoint inhibitor therapy (CIT) are needed. KRASG12C mutations are smoking-associated transversion mutations associated with high
Prognostic value of KRAS codon 13 gene mutation for overall survival in colorectal cancer
Kwak MS, et al.
Medicine, 96(35) (2017)
KRAS G12C Drug Development: Discrimination between Switch II Pocket Configurations Using Hydrogen/Deuterium-Exchange Mass Spectrometry
Lu J, et al.
Structure, 25(9), 1442-1448 (2017)
The prognostic value of KRAS mutation by cell-free DNA in cancer patients: a systematic review and meta-analysis.
Zhuang R, et al.
PLoS ONE, 12(8), e0182562-e0182562 (2017)
Mei Zeng et al.
Cell chemical biology, 27(1), 19-31 (2019-12-31)
KRAS is the most frequently mutated oncogene found in pancreatic, colorectal, and lung cancers. Although it has been challenging to identify targeted therapies for cancers harboring KRAS mutations, KRASG12C can be targeted by small-molecule inhibitors that form covalent bonds with cysteine

Preguntas

  1. Could you verify if Product No. SAB1404011, Monoclonal Anti-KRAS antibody, has cross-reactivity with N-Ras and H-Ras?

    1 respuesta
    1. We have not conducted experiments to determine whether Product No. SAB1404011, Monoclonal Anti-KRAS antibody, clone 4F3, will react with Human NRAS (UniProt P01111) and Human HRAS (UniProt P01112). However, based on the alignment data, there is a high probability of recognition, though we cannot guarantee it. In the comparison, the similarity between Human HRAS (UniProt P01112) and SAB1404011 KRAS monoclonal antibody, clone 4F3 is very high (96%), suggesting theoretical recognition. Similarly, the similarity between Human NRAS (UniProt P01111) and SAB1404011 KRAS monoclonal antibody, clone 4F3 is also very high (95%), indicating theoretical recognition.

      ¿Le ha resultado útil?

Revisiones

Sin puntuación

Filtros activos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico