Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

SAB1403813

Sigma-Aldrich

Monoclonal Anti-FGF8 antibody produced in mouse

clone 2A11, purified immunoglobulin, buffered aqueous solution

Sinónimos:

AIGF, HBGF-8, MGC149376

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

2A11, monoclonal

Formulario

buffered aqueous solution

mol peso

antigen ~33.6 kDa

reactividad de especies

human

técnicas

capture ELISA: suitable
indirect ELISA: suitable
proximity ligation assay: suitable

isotipo

IgG2aκ

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... FGF8(2253)

Descripción general

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein is known to be a factor that supports androgen and anchorage independent growth of mammary tumor cells. Overexpression of this gene has been shown to increase tumor growth and angiogensis. The adult expression of this gene is restricted to testes and ovaries. Temporal and spatial pattern of this gene expression suggests its function as an embryonic epithelial factor. Studies of the mouse and chick homologs revealed roles in midbrain and limb development, organogenesis, embryo gastrulation and left-right axis determination. The alternative splicing of this gene results in four transcript variants. (provided by RefSeq)

Inmunógeno

FGF8 (NP_149354, 65 a.a. ~ 133 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSR VRVRGAETGLYICMNKKGK

Acciones bioquímicas o fisiológicas

Fibroblast growth factor-8 (FGF-8) stimulates the proliferation and activation of cells that express the FGF receptors. It has a role in embryogenesis. FGF8b, an isoform of FGF-8, is expressed in prostate cancer.

Forma física

Solution in phosphate buffered saline, pH 7.4

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Screening a phage display library for a novel FGF8b-binding peptide with anti-tumor effect on prostate cancer.
Wang W
Experimental Cell Research, 319(8), 1156-1164 (2013)
A novel locus of ectodermal dysplasia maps to chromosome 10q24.32-q25.1.
Rafiq MA
The Journal of Investigative Dermatology, 124(2), 338-342 (2005)

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico