SAB1403138

Monoclonal Anti-SLC7A8, (C-terminal) antibody produced in mouse

clone 3F10, purified immunoglobulin, buffered aqueous solution

• Sinónimos: LAT2, LPI-PC1
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 3F10, monoclonal
• Formulario: buffered aqueous solution
• mol peso: antigen ~33.7 kDa
• reactividad de especies: human
• técnicas: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_012244
• Nº de acceso UniProt: Q9UHI5
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... SLC7A8(23428)

Descripción

Descripción general

Solute carrier family 7 member 8 (SLC7A8), also known as L-amino acid transporter-2 (LAT-2), is part of the amino acid transporters family. It is a subunit of the heavy chain of the surface antigen 4F2 (4F2hc). The protein is expressed in the placenta and fetal capillaries. The SLC7A8 gene is localized on human chromosome 14q11.2.

Inmunógeno

SLC7A8 (NP_036376.2, 467 a.a. ~ 535 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VYWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP

Acciones bioquímicas o fisiológicas

Solute carrier family 7 member 8 (SLC7A8) is involved in amino acid transport.It has a role in absorption of neutral amino acids in the kidney. Mutations in the gene encoding this protein have been linked to lysinuric protein intolerance.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable