SAB1402559

Monoclonal Anti-PVRL3 antibody produced in mouse

clone 1D1, purified immunoglobulin, buffered aqueous solution

• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 1D1, monoclonal
• Formulario: buffered aqueous solution
• mol peso: antigen ~37.99 kDa
• reactividad de especies: human
• técnicas: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_015480
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... PVRL3(25945)

Descripción

Descripción general

Poliovirus receptor-related 3 (PVRL3), popularly known as nectin cell adhesion molecule 3 (NECTIN3), is expressed in various cells. It is part of the nectin family of proteins, which are cell adhesion molecules that modulate adherens junction formation. PVRL3 is a membrane protein with three extracellular immunoglobulin domains. The gene encoding it is localized on human chromosome 3q13.13.

Inmunógeno

PVRL3 (NP_056295, 59 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PIIVEPHVTAVWGKNVSLKCLIEVNETITQISWEKIHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTV

Aplicación

Monoclonal Anti-PVRL3 antibody produced in mouse has been used for immunohistochemistry.

Acciones bioquímicas o fisiológicas

Poliovirus receptor-related 3 (PVRL3) or nectin cell adhesion molecule 3 (NECTIN3) forms heterotypic adhesions with PVR, PVRL1 and PVRL2. The protein is involved in lymphocyte and monocyte extravasation. It also associates with afadin. PVRL3 has a role in the development of mammalian lens and ciliary body.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable