SAB1402301

Monoclonal Anti-PCP4 antibody produced in mouse

clone 1E3, purified immunoglobulin, buffered aqueous solution

• Sinónimos: PEP-19
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• conjugado: unconjugated
• forma del anticuerpo: purified immunoglobulin
• tipo de anticuerpo: primary antibodies
• clon: 1E3, monoclonal
• formulario: buffered aqueous solution
• mol peso: antigen ~32.93 kDa
• reactividad de especies: human
• técnicas: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotipo: IgG2aκ
• Nº de acceso NCBI: NM_006198
• Nº de acceso UniProt: P48539
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... PCP4(5121)

Descripción

Descripción general

Purkinje cell protein 4 (PCP4) is an anti-apoptotic, calmodulin-binding peptide which is expressed in neural cells. It is also expressed in the Purkinje cells of the cerebellum, kidneys, prostate and the uterus. PCP4 is a 7.6kDa with an IQ-motif. The gene encoding this protein is localized on human chromosome 21q22.2.

Inmunógeno

PCP4 (NP_006189.2, 1 a.a. ~ 62 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS

Acciones bioquímicas o fisiológicas

Purkinje cell protein 4 (PCP4) may have a role in apoptosis and cellular degeneration. It acts as an accelerator of calcium association and disassociation with calmodulin. The protein also functions in synaptic plasticity.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable