Saltar al contenido
Merck
Todas las fotos(3)

Documentos clave

SAB1401583

Sigma-Aldrich

Monoclonal Anti-STAB1 antibody produced in mouse

clone 4G9, purified immunoglobulin, buffered aqueous solution

Sinónimos:

CLEVER-1, FEEL-1, FELE-1, FEX1, KIAA0246, STAB-1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μG
490,00 €

490,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad


Seleccione un Tamaño

Cambiar Vistas
100 μG
490,00 €

About This Item

Código UNSPSC:
12352203
NACRES:
NA.41

490,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad

origen biológico

mouse

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

purified immunoglobulin

tipo de anticuerpo

primary antibodies

clon

4G9, monoclonal

Formulario

buffered aqueous solution

reactividad de especies

human

técnicas

capture ELISA: suitable
immunofluorescence: suitable
western blot: 1-5 μg/mL

isotipo

IgG2aκ

Nº de acceso NCBI

Nº de acceso UniProt

Condiciones de envío

dry ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... STAB1(23166)

Descripción general

Stabilin 1 (STAB1) gene encodes a large, transmembrane receptor protein which may function in angiogenesis, lymphocyte homing, cell adhesion, or receptor scavenging. The protein contains 7 fasciclin, 16 epidermal growth factor (EGF)-like, and 2 laminin-type EGF-like domains as well as a C-type lectin-like hyaluronan-binding Link module. The protein is primarily expressed on sinusoidal endothelial cells of liver, spleen, and lymph node. The receptor has been shown to endocytose ligands such as low density lipoprotein, Gram-positive and Gram-negative bacteria, and advanced glycosylation end products. Supporting its possible role as a scavenger receptor, the protein rapidly cycles between the plasma membrane and early endosomes. (provided by RefSeq).
Stabilin 1 (STAB1) is expressed on tissue macrophages and sinusoidal endothelial cells. It is a type-1 transmembrane receptor. STAB1 is expressed in alternatively activated macrophages. STAB1 gene is located on human chromosome 3p21.1.

Inmunógeno

STAB1 (NP_055951, 1804 a.a. ~ 1902 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EALASDLPNLGPLRTMHGTPISFSCSRTRAGELMVGEDDARIVQRHLPFEGGLAYGIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQ

Acciones bioquímicas o fisiológicas

Stabilin 1 (STAB1) maintains tissue homeostasis and prevents autoimmunity. STAB1 mediates endocytic and phagocytic clearance of undesirable internal components. STAB1 is an immunosuppressive molecule and reduces proinflammatory reactions in vivo.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Stabilin-1, a homeostatic scavenger receptor with multiple functions
Kzhyshkowska J, et al.
Journal of Cellular and Molecular Medicine, 10(3) (2006)
Monocyte Stabilin-1 suppresses the activation of TH1 lymphocytes
Palani S, et al.
Journal of Immunology, 1500257-1500257 (2015)
Stabilin-1 mediates phosphatidylserine-dependent clearance of cell corpses in alternatively activated macrophages
Park S, et al.
Journal of Cell Science, 122(18) (2009)
Allelic expression analysis of the osteoarthritis susceptibility locus that maps to chromosome 3p21 reveals cis-acting eQTLs at GNL3 and SPCS1
Gee F, et al.
BMC Medical Genetics, 15(1), 53-53 (2014)
Multifunctional receptor stabilin-1 in homeostasis and disease
Kzhyshkowska J, et al.
TheScientificWorldJournal, 10(1) (2010)

Preguntas

Revisiones

Sin puntuación

Filtros activos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico