SAB1400775

Anti-CDCA5 antibody produced in mouse

IgG fraction of antiserum, buffered aqueous solution

• Sinónimos: Anti-MGC16386
• Código UNSPSC: 12352203
• NACRES: NA.41

Propiedades

• origen biológico: mouse
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: IgG fraction of antiserum
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Formulario: buffered aqueous solution
• reactividad de especies: human
• técnicas: indirect immunofluorescence: suitable; western blot: 1 μg/mL
• Nº de acceso UniProt: Q96FF9
• Condiciones de envío: dry ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... CDCA5(113130)

Descripción

Descripción general

CDCA5 (cell division cycle associated 5) gene is mapped to human chromosome 11q13.1. The gene codes for the protein sororin. The protein is localized in the nucleus. It is known to be conserved among the vertebrates.

Inmunógeno

CDCA5 (NP_542399.1, 1 a.a. ~ 252 a.a) full-length human protein.

Sequence
MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE

Acciones bioquímicas o fisiológicas

Sororin regulates proper cohesion and separation of sister chromatids during replication, by stabilizing cohesin on DNA. Phosphorylation of sororin by cyclin B during mitosis, reduces its potential to prevent Wap1 (cohesin release factor) and Pds5 (cohesin-interacting protein) binding.

Forma física

Solution in phosphate buffered saline, pH 7.4

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable