MSST0047

SILu^™Prot SOST, Sclerostin human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, ¹³C and ¹⁵N-labeled

• Código UNSPSC: 23201100
• NACRES: NA.12

Propiedades

• origen biológico: human
• Nivel de calidad: 200
• recombinante: expressed in HEK 293 cells
• etiqueta: 8-His tagged
• Análisis: ≥98% (SDS-PAGE)
• formulario: lyophilized powder
• potencia: ≥98% Heavy amino acids incorporation efficiency by MS
• técnicas: mass spectrometry (MS): suitable
• idoneidad: suitable for mass spectrometry (standard)
• Nº de acceso UniProt: Q9BQB4
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... SOST(50964)

Descripción

Descripción general

SILu^™Prot SOST is a recombinant, stable isotope-labeled human SOST which incorporates [¹³C₆, ¹⁵N₄]-Arginine and [¹³C₆, ¹⁵N₂]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of SOST in mass-spectrometry. SILu^™Prot SOST is a protein of 201 amino acids (including a N-terminal polyhistidine and tag), with a calculated molecular mass of 22.8 kDa.

Acciones bioquímicas o fisiológicas

Sclerostin is a secreted Wnt signaling antagonist produced almost exclusively by osteocytes. It can selectively inhibit Wnt/ β-catenin, suppressing the activity of osteoblasts as well as the viability of osteoblasts and osteocytes. Lower sclerostin levels are associated with lower bone mineral content and bone. It was demonstrated that greater total limb bone mineral content was significantly associated with greater circulating levels of sclerostin. In addition, circulating sclerostin is a biomarker of osteoporosis severity in long-term, chronic paraplegia. Serum sclerostin was associated significantly, independently, and positively with bone mineral density of both cortical and cancellous bone. Sclerostin is considered to be one of the factors associated with chronic kidney disease-mineral and bone disorder in hemodialysis patients.

Secuencia

HHHHHHHHGGQQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY

Forma física

Supplied as a lyophilized powder containing phosphate buffered saline.

Información legal

SILu is a trademark of Sigma-Aldrich Co. LLC

Información de seguridad

• Código de clase de almacenamiento: 11 - Combustible Solids
• Clase de riesgo para el agua (WGK): WGK 2
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable