MSST0044
SILu™Lite TIMP1, Metalloproteinase inhibitor 1 human
recombinant, expressed in HEK 293 cells, MS Protein Standard
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Seleccione un Tamaño
50 μG
687,00 €
687,00 €
Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad
Solicitar un pedido a granel
Seleccione un Tamaño
Cambiar Vistas
50 μG
687,00 €
About This Item
Código UNSPSC:
23201100
NACRES:
NA.12
687,00 €
Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad
Solicitar un pedido a granel
Categorías relacionadas
Descripción general
SILu™Lite TIMP1 is a recombinant human protein expressed in human 293 cells. It consists of 184 amino acids, with a calculated molecular mass of 20.7 kDa. SILu™Lite TIMP1 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Acciones bioquímicas o fisiológicas
TIMP-1 is glycoprotein that is over-expressed in the supernatant of tissue extracts of breast, gastric, colorectal, and hepatocellular carcinomas. It belongs to the family of “tissue inhibitors of metalloproteinases,” a group of proteins that help regulate bone turnover. TIMP-1 serum levels are significantly associated with HER2 extracellular domain (ECD)-positivity and poorer disease-free survival among primary breast cancer patients with HER2 overexpression. High levels of serum TIMP-1 correlate with advanced disease and predict for poor survival in patients with multiple myeloma treated with bortezomib and/or IMiDs during their disease course.
Secuencia
CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA
Forma física
Supplied as a lyophilized powder containing phosphate buffered saline.
Información legal
SILu is a trademark of Sigma-Aldrich Co. LLC
Código de clase de almacenamiento
11 - Combustible Solids
Clase de riesgo para el agua (WGK)
WGK 2
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Filtros activos
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico
