MSST0037

SILu^™Prot IGFBP7 Insulin-like growth factor-binding protein 7 human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, ¹³C and ¹⁵N-labeled

• Sinónimos: IBP-7, IGF-binding protein 7, IGF-bindingprotein7, IGFBP-7, IGFBP-rP1, MAC25 protein, PGI2-stimulating factor, Prostacyclin-stimulating factor, Tumor-derived adhesion factor (TAF)
• Código UNSPSC: 23201100
• NACRES: NA.12

Propiedades

• origen biológico: human
• Nivel de calidad: 200
• recombinante: expressed in HEK 293 cells
• Ensayo: ≥98% (SDS-PAGE)
• Formulario: lyophilized powder
• potencia: ≥98 Heavy amino acids incorporation efficiency by MS
• técnicas: mass spectrometry (MS): suitable
• idoneidad: suitable for mass spectrometry (standard)
• Nº de acceso UniProt: Q16270
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... IGFBP7(3490)

Descripción

Descripción general

IGFBP7 regulates the availability of insulin-like growth factors (IGFs) in tissue, and modulates IGF binding to its receptors. IGFBP7 binds to IGF with high affinity. Several studies have shown the involvement of IGFBP7 in Acute Kidney Injury (AKI), where its levels can predict patients at risk for developing AKI. When combined with TIMP-2, the accuracy of AKI risk prediction is further increased. Urinary [TIMP-2]×[IGFBP7] test sufficiently detects patients with risk of AKI after major non-cardiac surgery. In addition, Urinary [TIMP-2]×[IGFBP7] serves as a sensitive and specific biomarker to predict AKI early after cardiac surgery and to predict renal recovery.

Inmunógeno

HHHHHHHHGGQSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL

Acciones bioquímicas o fisiológicas

SILu^™Prot IGFBP7 is a recombinant, stable isotope-labeled human IGFBP7 which incorporates [¹³C₆, ¹⁵N₄]-Arginine and [¹³C₆, ¹⁵N₂]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of IGFBP7 in mass-spectrometry. SILu Prot IGFBP7 is a protein consisting of 267 amino acids (including an N-terminal polyhistidine tag), with a calculated molecular mass of 28 kDa.

Forma física

Supplied as a lyophilized powder containing phosphate buffered saline.

Información legal

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected].

SILu is a trademark of Sigma-Aldrich Co. LLC

Información de seguridad

• Código de clase de almacenamiento: 11 - Combustible Solids
• Clase de riesgo para el agua (WGK): WGK 2
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable