Saltar al contenido
Merck

MSST0015

Sigma-Aldrich

SILuProt B2M beta-2-microglobulin human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, 13C- and 15N-labeled

Sinónimos:

β-2-microglobulin

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

10 μG
708,00 €

708,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad

Solicitar un pedido a granel

Seleccione un Tamaño

Cambiar Vistas
10 μG
708,00 €

About This Item

Código UNSPSC:
23201100
NACRES:
NA.12

708,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad

Solicitar un pedido a granel

origen biológico

human

Nivel de calidad

recombinante

expressed in HEK 293 cells

Ensayo

≥98% (SDS-PAGE)

Formulario

lyophilized powder

potencia

≥98% Heavy amino acids incorporation efficiency by MS

técnicas

mass spectrometry (MS): suitable

idoneidad

suitable for mass spectrometry (standard)

Nº de acceso UniProt

temp. de almacenamiento

−20°C

Información sobre el gen

human ... B2M(567)

Descripción general

SILu Prot B2M is a recombinant, stable isotope-labeled human B2M which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of B2M in mass-spectrometry. SILu Prot B2M is a monomer of 119 amino acids (including C-terminal polyhistidine and flag tags), with a molecular weight of ~14 kDa.
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)

Acciones bioquímicas o fisiológicas

B2M is the light chain of the major histocompatibility class (MHC) I molecule expressed on the cell surface of all nucleated cells. Increased urinary B2M excretion has been observed to be an early marker of tubular injury in a number of settings, including nephrotoxicant exposure, cardiac surgery, and renal transplantation, preceding rises in serum creatinine by as many as 4−5 days. B2M may also serve as an early biomarker for AKI (Acute Kidney Injury).

Secuencia

IQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDMDYKDDDDKGHHHHHHHHGGQ

Forma física

Supplied as a lyophilized powder containing phosphate buffered saline.

Información legal

SILu is a trademark of Sigma-Aldrich Co. LLC

Código de clase de almacenamiento

11 - Combustible Solids

Clase de riesgo para el agua (WGK)

WGK 2

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Preguntas

Revisiones

Sin puntuación

Filtros activos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico