MSST0006
SILu™Lite VEGFA Vascular endothelial growth factor A human
recombinant, expressed in HEK 293 cells, MS Protein Standard
Sinónimos:
SILuLite Vascular endothelial growth factor A
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
Código UNSPSC:
23201100
NACRES:
NA.12
Productos recomendados
origen biológico
human
Nivel de calidad
recombinante
expressed in HEK 293 cells
Análisis
≥98% (SDS-PAGE)
formulario
lyophilized powder
técnicas
mass spectrometry (MS): suitable
Nº de acceso UniProt
temp. de almacenamiento
−20°C
Información sobre el gen
human ... VEGFA(7422)
Categorías relacionadas
Descripción general
SILu™ Lite VEGF165 is a recombinant glycosylated human protein expressed in human 293 cells. It is a homodimer with an apparent molecular mass of 45 kDa.
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)
Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)
Acciones bioquímicas o fisiológicas
VEGF165 belongs to the PDGF/VEGF growth factor family characterized by the presence of eight conserved cysteine residues and a cystine knot structure.1 VEGF is secreted by the majority of tumor cells and initiates angiogenesis by activating endothelial cells of existing blood vessels and promoting their migration.2
VEGF has also been implicated in correlation with poor prognosis in breast cancer.2 In addition, VEGF is released in rheumatoid arthritis in response to TNF-α, increasing endothelial permeability and stimulating angiogenesis (formation of capillaries)3,4
VEGF has also been implicated in correlation with poor prognosis in breast cancer.2 In addition, VEGF is released in rheumatoid arthritis in response to TNF-α, increasing endothelial permeability and stimulating angiogenesis (formation of capillaries)3,4
Secuencia
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGC
Forma física
Supplied as a lyophilized powder containing phosphate buffered saline
Información legal
SILu is a trademark of Sigma-Aldrich Co. LLC
Código de clase de almacenamiento
11 - Combustible Solids
Clase de riesgo para el agua (WGK)
WGK 2
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico