MSQC4
SILu™Lite SigmaMAb Universal Antibody Standard human
Sinónimos:
IgG1 light, Mass Spectrometry Universal Antibody Standard, SILu™Lite SigmaMAb Universal Antibody Standard human, recombinant IgG1 lambda light antibody, SigmaMAb
Seleccione un Tamaño
338,00 €
Seleccione un Tamaño
About This Item
338,00 €
Productos recomendados
recombinante
expressed in CHO cells
Nivel de calidad
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
Descripción general
It consists of two identical heavy chains and two identical light chains. The heavy chains and light chains are linked by one disulfide bond. The heavy chains are linked by two disulfide bonds located in a hinge domain. The other 12 cysteine bonds are intramolecularly restricted to six different globular domains. The antibody sequence has been evaluated by intact mass and peptide mapping using four different enzymes: chymotrypsin, Asp-N and Glu-C endoproteinases and trypsin. Sequence coverage of 100% was obtained.
Aplicación
Características y beneficios
Description / Composition / Modification / Average Mass (Da)
Light chain, reduced / C1006H1555N267O333S7 / Pyroglutamic acid (Q) / 22942.2
Heavy chain, reduced / C2181H3393N587O663S16 / (no modification) / 48957.8
C2237H3485N591O702S16 / G0F / 50403.2
C2243H3495N591O707S16 / G1F / 50565.3
C2249H3505N591O712S16 / G2F / 50727.5
Native intact mass, non-reduced / C6374H9864N1708O1992S46 / 2 X Pyroglutamic acid (Q) / 143767.7
C6486H10048N1716O2070S46 / G0F+G0F / 146658.4
C6492H10058N1716O2075S46 / G0F+G1F / 146820.6
C6498H10068N1716O2080S46 / G1F+G1F / 146982.7
C6504H10078N1716O2085S46 / G1F+G2F / 147144.8
C6510H10088N1716O2090S46 / G2F+G2F / 147307.0
Forma física
Nota de preparación
Nota de análisis
EVQLVESGGGLVQPGGSLRLSCVASGFTLNNYDMHWVRQGIGKGLEWVSKI
GTAGDRYYAGSVKGRFTISRENAKDSLYLQMNSLRVGDAAVYYCARGAGRW
APLGAFDIWGQGTMVTVSS|ASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF
PEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISR
TPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV
VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
RDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SigmaMab Light Chain
QSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNFVSWYQQHPGKAPKLMIY
DATKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGDYTPGV
VFGGGTKLTVL|GQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTV
AWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQ
VTHEGSTVEKTVAPTECS
Otras notas
Reconstitute the contents of the vial by adding 500μL of ultrapure water or phosphate buffer, and mixing vigorously. The solubilized product can be further diluted as needed.
Información legal
Producto relacionado
suplemento
Código de clase de almacenamiento
11 - Combustible Solids
Clase de riesgo para el agua (WGK)
WGK 1
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Los clientes también vieron
Artículos
Residual presence of host cell proteins (HCPs) in recombinant therapeutic products has considerable clinical safety risks associated with a potential immunological response in patients.
Method development for titer determination of three different monoclonal antibodies - cetuximab, trastuzumab, and universal antibody standard using a Chromolith® WP 300 Protein A column.
Compare columns in resolving medium-sized antibody fragments after digestion with DTT or IdeS using Reversed-Phase Chromatography for analysis.
Intact analysis of Universal Antibody Standard human and Antibody-Drug Conjugate (ADC) Mimic on silica monolithic HPLC columns under various conditions.
Protocolos
Here we show how LC and MS methods may be optimized using a non-toxic surrogate of the ADC, an “ADC-mimic”, that behaves very similarly to the Cys-linked ADC Adcetris (Seattle Genetics).
SigmaMab Antibody Drug Conjugate Mimic, is a non-toxic drug mimic utilized as a standard for mass spectrometry and high performance liquid chromatography.
BIOshell™ IgG 1000 Å C4 UHPLC Column for Improved Biomacromolecule Separations
Contenido relacionado
Descubra nuestra amplia variedad de productos para el análisis de masa intacta de anticuerpos monoclonales, entre otros, las columnas de exclusión por tamaño (SEC), las columnas de intercambio iónico, las columnas de fase inversa, los tampones para HPLC, las matrices y los patrones MALDI, disolventes de gran pureza, reactivos, herramientas para la preparación de muestras proteicas y materiales de referencia certificados.
Discover our wide variety of products for intact mass analysis of monoclonal antibodies, including size-exclusion columns (SEC), ion exchange columns, reverse-phase columns, HPLC buffers, MALDI matrices and standards, high-purity solvents, reagents, tools for protein sample preparation, and certified reference materials.
Filtros activos
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico