MSQC28
SILu™Lite SigmaMAb Vedolizumab Monoclonal Antibody
recombinant, expressed in CHO cells
Sinónimos:
Biologic Antibody Mimic, Biotherapeutic Antibody Mimic, Monoclonal Antibody Calibrator
Seleccione un Tamaño
| Talla/SKU | Disponibilidad | Precio |
|---|---|---|
0.5 mg | Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad | 340,00 € |
Acerca de este artículo
340,00 €
recombinant
expressed in CHO cells
Quality Segment
assay
≥90% (HPLC)
form
solid
technique(s)
protein mass spectrometry: suitable
suitability
suitable for mass spectrometry
shipped in
wet ice
storage temp.
−20°C
General description
SigmaMAb Vedolizumab is for research use only and is not intended for diagnostic or therapeutic use.
Other Notes
QVQLVQSGAEVKKPGASVKVSCKGSGYTFTSYWMHWVRQAPGQRLEWIGEIDPSESNTNYNQKFKGRVTLTVDISASTAYMELSSLRSEDTAVYYCARGGYDGWDYAIDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELAGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG
SigmaMAb Vedolizumab Light Chain:
DVVMTQSPLSLPVTPGEPASISCRSSQSLAKSYGNTYLSWYLQKPGQSPQLLIYGISNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCLQGTHQPYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Legal Information
1 of 1
Este artículo | |||
|---|---|---|---|
| description recombinant, expressed in CHO cells | description recombinant, expressed in CHO cells | description recombinant, expressed in CHO cells | description recombinant, expressed in CHO cells |
| storage temp. −20°C | storage temp. −20°C | storage temp. −20°C | storage temp. −20°C |
| shipped in wet ice | shipped in wet ice | shipped in wet ice | shipped in wet ice |
| form solid | form solid | form solid | form solid |
| assay ≥90% (HPLC) | assay ≥90% (SDS-PAGE) | assay ≥90% (SDS-PAGE) | assay ≥90% (SDS-PAGE) |
| recombinant expressed in CHO cells | recombinant expressed in CHO cells | recombinant expressed in CHO cells | recombinant expressed in CHO cells |
| suitability suitable for mass spectrometry | suitability suitable for mass spectrometry | suitability suitable for mass spectrometry | suitability suitable for mass spectrometry |
Clase de almacenamiento
13 - Non Combustible Solids
¿Qué está pasando?
WGK 3
Elija entre una de las versiones más recientes:
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.