HPA031149

Anti-CD200 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-CD200 molecule, Anti-MOX1, Anti-MOX2, Anti-MRC, Anti-OX-2, Anti-ST1C1, Anti-SULT1C1
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA031149

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• validación mejorada: orthogonal RNAseq; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• técnicas: immunohistochemistry: 1:50- 1:200
• secuencia del inmunógeno: EREQLYTPASLKCSLQNAQEALIVTWQKKKAVSPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVYVQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRS
• Nº de acceso UniProt: P41217
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• Información sobre el gen: human ... CD200(4345)

Descripción

Descripción general

CD200 (CD_antigen 200) gene is mapped to human chromosome 3q13.2. The gene encodes a transmembrane glycoprotein that belongs to the immunoglobulin superfamily. CD200 is widely expressed in different tissues and cell types such as lymphocytes, kidney glomeruli, neurons and endothelial cells. Its receptor is mainly expressed by myeloid cells (granulocytes, monocytes and macrophages).

Inmunógeno

CD200 molecule recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies^®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-CD200 antibody produced in rabbit has been used in immunofluorescence.

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunofluorescence (1 paper)

Acciones bioquímicas o fisiológicas

CD200 (CD_antigen 200) has an immunosuppressive effect on cells expressing its receptor, CD200R. CD200 is involved in maintaining immune homeostasis. CD200 reduces the immune system′s reaction to vaccines, while inhibition of CD200 expression can enhance the efficacy of cancer immunotherapy. The gene is known to be overexpressed in a number of human cancers. CD200 mostly supports tumor growth and invasion, by suppressing anti-tumor immune responses, while it is also known to inhibit melanoma cells from forming tumors or metastasizing into the lung. CD200 is considered as a biomarker in colon cancer and cutaneous squamous cell carcinoma. Deficiency of CD200 results in hyperactivation of macrophages and enhanced immune response to autoimmune disease.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST86190.

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable