HPA019263
Anti-PPM1E antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2
Sinónimos:
Anti-CaMKN, Anti-CaMKP-N, Anti-CaMKP-nucleus, Anti-Partner of PIX 1, Anti-Partner of PIXA, Anti-Protein phosphatase 1E
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Seleccione un Tamaño
100 μL
542,00 €
542,00 €
Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad
Seleccione un Tamaño
Cambiar Vistas
100 μL
542,00 €
About This Item
542,00 €
Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad
Productos recomendados
origen biológico
rabbit
Nivel de calidad
conjugado
unconjugated
forma del anticuerpo
affinity isolated antibody
tipo de anticuerpo
primary antibodies
clon
polyclonal
Línea del producto
Prestige Antibodies® Powered by Atlas Antibodies
Formulario
buffered aqueous glycerol solution
reactividad de especies
human
técnicas
immunohistochemistry: 1:200- 1:500
secuencia del inmunógeno
TVIVVFLRDMNKAVNVSEESDWTENSFQGGQEDGGDDKENHGECKRPWPQHQCSAPADLGYDGRVDSFTDRTSLSPGSQINVLE
Nº de acceso UniProt
Condiciones de envío
wet ice
temp. de almacenamiento
−20°C
modificación del objetivo postraduccional
unmodified
Información sobre el gen
human ... PPM1E(22843)
Descripción general
The gene PPM1E (protein phosphatase Mg2+/Mn2+ dependent 1E) is mapped to human chromosome 17q22. It belongs to PPM family. PPM1E is abundantly expressed in brain and testis.
Inmunógeno
Protein phosphatase 1E recombinant protein epitope signature tag (PrEST)
Aplicación
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Acciones bioquímicas o fisiológicas
The autophosphorylation of p21 (CDC42/Rac)-activated kinase PAK is crucial for mediating cellular functions. The protein phosphatase Mg2+/Mn2+ dependent 1E (PPM1E) interacts with the PAK (p21-activated kinase) interacting guanine nucleotide exchange factor (PIX). The dephosphrylation action of PPM1E suppresses active PAK responses. PPM1E is also a phosphatase for 5′-AMP-activated protein kinase (AMPK). Activation and phosphorylation of AMPK is important for treatment of type-2 diabetes.
Características y beneficios
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Ligadura / enlace
Corresponding Antigen APREST73653
Forma física
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Información legal
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Código de clase de almacenamiento
10 - Combustible liquids
Clase de riesgo para el agua (WGK)
WGK 1
Punto de inflamabilidad (°F)
Not applicable
Punto de inflamabilidad (°C)
Not applicable
Elija entre una de las versiones más recientes:
Certificados de análisis (COA)
Lot/Batch Number
¿No ve la versión correcta?
Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
Cheng-Gee Koh et al.
Current biology : CB, 12(4), 317-321 (2002-02-28)
The Rho GTPases are involved in many signaling pathways and cellular functions, including the organization of the actin cytoskeleton, regulation of transcription, cell motility, and cell division. The p21 (Cdc42/Rac)-activated kinase PAK mediates a number of biological effects downstream of
Wenjing Sun et al.
The Journal of biological chemistry, 285(28), 21341-21348 (2010-05-08)
MEKK3 is a central intermediate signaling component in lysophosphatidic acid (LPA)-induced activation of the nuclear factor-kappaB (NF-kappaB). However, the precise mechanism for the termination of MEKK3 kinase activity is not fully understood. Using a functional genomic approach, we have identified
Martin Voss et al.
Cellular signalling, 23(1), 114-124 (2010-08-31)
Activation of 5'-AMP-activated protein kinase (AMPK) is believed to be the mechanism by which the pharmaceuticals, metformin and phenformin, exert their beneficial effects for treatment of type 2 diabetes. These biguanide drugs elevate 5'-AMP, which allosterically activates AMPK and promotes
K Litchfield et al.
Andrology, 3(1), 34-46 (2015-01-20)
Testicular germ cell tumour (TGCT) is the most common cause of cancer in young men (aged 15-45 years) in many populations. Multiple genome-wide association studies (GWAS) of TGCT have now been conducted, yielding over 25 disease-associated single-nucleotide polymorphism (SNP)s at 19
Filtros activos
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico
