Saltar al contenido
Merck

HPA017893

Sigma-Aldrich

Anti-RRP1B antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

Sinónimos:

Anti-KIAA0179, Anti-Nnp1, Anti-PPP1R136, Anti-RRP1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
542,00 €

542,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad


Seleccione un Tamaño

Cambiar Vistas
100 μL
542,00 €

About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41

542,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

validación mejorada

RNAi knockdown
Learn more about Antibody Enhanced Validation

técnicas

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000

secuencia del inmunógeno

SISQLSFAEDISADEDDQILSQGKHKKKGNKLLEKTNLEKEKGSRVFCVEEEDSESSLQKRRRKKKKKHHLQPENPGPGGAAPSLEQNRGREPEASGLKALKARVAEPGAEATSSTG

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

Categorías relacionadas

Descripción general

Ribosomal RNA processing 1B (RRP1B) is a 52kDa protein[1] mainly located in the nucleolus. It possesses a nucleolar protein of 52kDa (NOP52) homology domain and an RVxF (Arg/Lys-Val/Ile-Xaa-Phe/Trp) motif.[1] The gene encoding RRP1B is localized to human chromosome 21.

Inmunógeno

Ribosomal RNA processing protein 1 homolog B recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-RRP1B antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige. Anti-RRP1B antibody produced in rabbit has been used for co-immunoprecipitation.

Acciones bioquímicas o fisiológicas

Ribosomal RNA processing 1B (RRP1B) is a metastasis modifier protein in breast cancer. It interacts with signal-induced proliferation-associated 1(SIPA1) and functions in the reduction of tumor growth. The expression of RRP1B regulates many extra cellular matrix (ECM) genes which are linked with tumor suppression. The protein has an effect on gene expression by regulating histone methylation and heterochromatinization. Along with bromodomain-containing protein 4 (Brd4), RRP1B transduces extracellular mechanistic signals to the nucleus.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST73881

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

M Lee et al.
Oncogene, 33(14), 1818-1827 (2013-04-23)
RRP1B (ribosomal RNA processing 1 homolog B) was first identified as a metastasis susceptibility gene in breast cancer through its ability to modulate gene expression in a manner that can be used to accurately predict prognosis in breast cancer. However
Evolutionary breakpoints on human chromosome 21.
MT Davisson
Genomics, 78(1-2), 99-106 (2001)
Santhoshi Rani Nanchari et al.
Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine, 36(2), 615-621 (2014-10-04)
Rrp1B (ribosomal RNA processing1 homolog B) is a novel candidate metastasis modifier gene in breast cancer. Functional gene assays demonstrated that a physical and functional interaction existing between Rrp1b and metastasis modifier gene SIPA1 causes reduction in the tumor growth
Delphine Chamousset et al.
Molecular biology of the cell, 21(23), 4212-4226 (2010-10-12)
A pool of protein phosphatase 1 (PP1) accumulates within nucleoli and accounts for a large fraction of the serine/threonine protein phosphatase activity in this subnuclear structure. Using a combination of fluorescence imaging with quantitative proteomics, we mapped the subnuclear localization
Minnkyong Lee et al.
Molecular cancer research : MCR, 12(12), 1818-1828 (2014-08-06)
Overexpression of ribosomal RNA processing 1 homolog B (RRP1B) induces a transcriptional profile that accurately predicts patient outcome in breast cancer. However, the mechanism by which RRP1B modulates transcription is unclear. Here, the chromatin-binding properties of RRP1B were examined to

Preguntas

Revisiones

Sin puntuación

Filtros activos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico