HPA014849

Anti-KCNE3 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-MinK-related peptide 2, Anti-Minimum potassium ion channel-related peptide 2, Anti-Potassium channel subunit beta MiRP2, Anti-Potassium voltage-gated channel subfamily E member 3
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA014849
• NACRES: NA.43

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• técnicas: immunohistochemistry: 1:1000- 1:2500
• secuencia del inmunógeno: METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDN
• Nº de acceso UniProt: Q9Y6H6
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... KCNE3(10008)

Descripción

Descripción general

KCNE3 (potassium channel, voltage gated subfamily E regulatory β subunit 3) encodes the β subunit of potassium channel, which associates with multiple α subunits, to form a channel complex. This gene is localized to human chromosome 11q13-14, and is expressed in brain, inner ear and heart. It belongs to the KCNE family, which contains five members, from KCNE1-5.

Inmunógeno

Potassium voltage-gated channel subfamily E member 3 recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Acciones bioquímicas o fisiológicas

KCNE3 (potassium channel, voltage gated subfamily E regulatory β subunit 3) interacts with KCNE1, to control the transport, surface expression and activation of KCNH3, a potassium channel, in cortex and other regions of the central nervous system (CNS). Its chromosomal location is the locus for autosomal recessive, non-syndromal hearing disorder. It acts as an inhibitory β- subunit, and regulates the activity of K_v4.3 channel. Mutation in this gene is associated with Brugada-pattern electrocardiogram (ECG) and neurally mediated syncope (NMS). Thus, it might have some role in the pathogenesis of Brugada syndrome (BrS). Variants in this gene are also linked to long QT syndrome (LQTS), which is an inherited disorder. This protein also interacts with K_v7.1, which results in acceleration in the activation and decay of the current.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST72451

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)