HPA014545

Anti-CLCN2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-Chloride channel protein 2, Anti-ClC-2
• Número MDL: MFCD02096079
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA014545
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• técnicas: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• secuencia del inmunógeno: GVDHAYVTSIGRLIGIVTLKELRKAIEGSVTAQGVKVRPPLASFRDSATSSSDTETTEVHALWGPHSRHG
• Nº de acceso UniProt: P51788
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... CLCN2(1181)

Descripción

Descripción general

CLCN2 (chloride channel, voltage-sensitive 2) is a member of the voltage gated Cl^- channels and Cl^-/H⁺ exchangers called ClC family of proteins. The mammalian family consists of nine members including CLCN2. This protein has a ubiquitous expression pattern. It has a predominant expression in brain, pancreas, kidney and intestine. This protein is localized intracellulary in the basolateral membrane of polarized cells. It exists as aggregates on the cell surface, and some proportion of it localized with lipid rafts. This protein consists of two putative phosphorylation sites in its N-terminal, and seven in its C-terminal.

Inmunógeno

Chloride channel protein 2 recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Acciones bioquímicas o fisiológicas

CLCN2 (chloride channel, voltage-sensitive 2) has a high level of expression in the brain, where it mediates inhibitory γ-aminobutyric acid (GABA) response. It maintains low intracellular Cl^- levels, to achieve this. Hyperpolarization of membrane and intracellular anion concentration activate CLCN2, and it is involved in solute transport across epithelial cells. It is expressed in lung epithelia, where it is capable of Cl^- transport. It might also be involved in the morphogenesis of lungs. In astrocytes, this protein is involved in the maintenance of extracellular electrolyte homeostasis. Mutation M200fsX231 produces an extremely truncated CLCN2 protein, and might be linked with idiopathic generalized epilepsy. Studies also suggest that this protein might be associated with atherosclerosis and constipation-associated irritable bowel disease. Studies show that the susceptibility to a subset of childhood absence epilepsies maybe linked to CLCN2 gene locus.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST72848

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)