Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

HPA014536

Sigma-Aldrich

Anti-FGD5 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab1

Sinónimos:

Anti-FYVE, RhoGEF and PH domain-containing protein 5, Anti-Zinc finger FYVE domain-containing protein 23

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
542,00 €

542,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad


Seleccione un Tamaño

Cambiar Vistas
100 μL
542,00 €

About This Item

Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41

542,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

técnicas

immunohistochemistry: 1:20- 1:50

secuencia del inmunógeno

NSPQLKSRTGKLRASESPSSLIFYRDGKRKGVPFSRTVSRVESFEDRSRPPFLPLPLTKPRSISFPSADTSDYENIPAMNSDYENIQIPPRRPARAGAFTKLFEDQSRALSTANENDGYVD

Nº de acceso UniProt

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... FGD5(152273)

Descripción general

Facio-genital dysplasia-5 (FGD5) belongs to Rho GTP-GDP exchange factors family. This protein is composed of a Dbl homology (DH) domain, a PH (Pleckstrin homology) domain, a FYVE-finger domain and a second PH domain located at the C-terminal. It is exclusively expressed in both mature and progenitor endothelial cells (ECs). It resides in early endosomes and membrane ruffles.

Inmunógeno

FYVE, RhoGEF and PH domain-containing protein 5 recombinant protein epitope signature tag (PrEST)

Aplicación

Anti-FGD5 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Acciones bioquímicas o fisiológicas

The function of Facio-genital dysplasia-5 (FGD5) is yet unknown. It causes vaso-obliteration through apoptosis by activating hey1-p53 pathway. Through this mechanism, it prevents neo-vascularization. It also binds to and activates cdc42. It is therefore, involved in vascular pruning during vascular remodeling through apoptosis of endothelial cells (ECs). It regulates phosphatidylinositol 3-kinase signaling, and thereby controls the survival and adhesion of endothelial cells. As FGD5 is localized to membrane ruffles, it might control EC structure, adhesion and migration via controlling the reorganization of actin cytoskeleton. It is also found in early endosome, and thus, might play a role in membrane transport through the activation of cdc42. It might also be involved in the activation of ERK (extracellular signal-regulated kinases) and thus, play a role in membrane ruffling.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST72675

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Punto de inflamabilidad (°F)

Not applicable

Punto de inflamabilidad (°C)

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Maryam Nakhaei-Nejad et al.
Arteriosclerosis, thrombosis, and vascular biology, 32(11), 2694-2701 (2012-08-28)
The function of the endothelial cell (EC)-enriched Rho family guanine nucleotide exchange factor, facio-genital dysplasia-5 (FGD5), is poorly understood. We sought to determine whether FGD5 regulates endothelial cytoskeletal reorganization and angiogenesis. We observed that FGD5 is expressed in primary human
Yusuke Kurogane et al.
Arteriosclerosis, thrombosis, and vascular biology, 32(4), 988-996 (2012-02-14)
Vascular endothelial growth factor (VEGF) exerts proangiogenic action and induces activation of a variety of proangiogenic signaling pathways, including the Rho family small G proteins. However, regulators of the Rho family small G proteins in vascular endothelial cells (ECs) are
Caroline Cheng et al.
Circulation, 125(25), 3142-3158 (2012-06-05)
New vessel formation contributes to organ development during embryogenesis and tissue repair in response to mechanical damage, inflammation, and ischemia in adult organisms. Early angiogenesis includes formation of an excessive primitive network that needs to be reorganized into a secondary

Preguntas

Revisiones

Sin puntuación

Filtros activos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico