HPA014319

Anti-MEGF9 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-EGF-like domain-containing protein 5, Anti-Multiple EGF-like domain protein 5, Anti-Multiple epidermal growth factor-like domains 9 precursor
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA014319
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• técnicas: immunohistochemistry: 1:20- 1:50
• secuencia del inmunógeno: YQNRKLNAPFWTIELKEDNISFSSYHDSIPNADVSGLLEDDGNEVAPNGQLTLT
• Nº de acceso UniProt: Q9H1U4
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... MEGF9(1955)

Descripción

Descripción general

The gene MEGF9 (multiple epidermal growth factor-like domains 9) encodes a transmembrane protein containing multiple EGF-like repeats. The N-terminus contains several potential O-glycosylation sites followed by five EGF-like domains. It also contains a single pass transmembrane domain followed by a highly conserved short intracellular domain that has potential phosphorylation sites. The mRNA is found to be expressed in the developing and adult CNS (central nervous system) and PNS (peripheral nervous system), particularly in Purkinje cells of the cerebellum and in glial cells of the PNS. It is also found to some extent in the epidermal layer of skin, papillae of the tongue and the epithelium of the gastrointestinal tract. The gene is mapped to human chromosome 9q32–9q33.3. The human gene consists of six exons spanning a length of 113.66kb. The signal peptide sequence and an N-terminal domain are encoded by exon 1, exons 2–5 encode EGF-like repeats 1–5, and exon 6 encodes a transmembrane region and a cytoplasmic tail. A long untranslated region of 4326bp is also encoded by exon 6. The 3′ end contains a conserved polyadenylation site.

Inmunógeno

Multiple epidermal growth factor-like domains 9 precursor recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Acciones bioquímicas o fisiológicas

The gene MEGF9 (multiple epidermal growth factor-like domains 9) encodes a novel putative receptor that may function as a guidance or signaling molecule. It is regulated during development. The exact function of this protein is yet to be characterized. Proteins containing EGF-like domains usually participate in the development, maintenance and injury response of the nervous system.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST72839

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)