HPA008905

Anti-DMPK antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-DM-kinase antibody produced in rabbit, Anti-DMK antibody produced in rabbit, Anti-MDPK antibody produced in rabbit, Anti-MT-PK antibody produced in rabbit, Anti-Myotonic dystrophy protein kinase antibody produced in rabbit, Anti-Myotonin-protein kinase antibody produced in rabbit
• Número MDL: MFCD03454954
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA008905

Propiedades

• origen biológico: rabbit
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• validación mejorada: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• técnicas: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• secuencia del inmunógeno: LGVFAYEMFYGQTPFYADSTAETYGKIVHYKEHLSLPLVDEGVPEEARDFIQRLLCPPETRLGRGGAGDFRTHPFFFGLDWDGLRDSVPPFTPDFEGATDTCNFDLVE
• Nº de acceso UniProt: Q09013
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... DMPK(1760)

Descripción

Descripción general

DMPK (dystrophia myotonica protein kinase) gene is localized to human chromosome 19q13.3, which codes for a Ser/Thr kinase. This gene is localized to myotonic dystrophy (DM) locus, and belongs to the myotonic dystrophy proteinkinase family. This gene is composed of 15 exons, and the mRNA is highly alternatively spliced. This gives rise to multiple isoforms of this protein, and they all have in common a leucine-rich domain in N-terminal, a serine/threonine kinase domain, a C-terminal protein kinase domain and a coiled-coil region.

Inmunógeno

Myotonin-protein kinase recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Acciones bioquímicas o fisiológicas

Expansion of CTG repeats in the 3′ UTR (untranslated region) this gene leads to the disorder Myotonic dystrophy type 1 (DM1). Normally this gene contains 5-37 CTG repeats, whereas DM1 patients contain 50 to several thousand CTG repeats in the 3′UTR. In vitro studies show that adenosinetriphosphate facilitates the unwinding of CTG-duplex repeats by DDX6 (DEAD-box helicase 6) protein. Thus, DDX6 is capable of releasing and remodeling nuclear DMPK messenger ribonucleoprotein foci, which can reverse pathogenic alternative splicing. This protein leads to reorganization of actin cytoskeleton and removal of membrane organelles during differentiation of normal lens. However, in DM1 lenses it results in the retention of the intracellular membrane organelles.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST71376

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)