Saltar al contenido
Merck

HPA008736

Sigma-Aldrich

Anti-DAXX antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

Anti-Daxx antibody produced in rabbit, Anti-Death domain-associated protein 6 antibody produced in rabbit, Anti-EAP1 antibody produced in rabbit, Anti-ETS1-associated protein 1 antibody produced in rabbit, Anti-Fas death domain-associated protein antibody produced in rabbit, Anti-hDaxx antibody produced in rabbit

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización

Seleccione un Tamaño

100 μL
505,00 €

505,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad


Seleccione un Tamaño

Cambiar Vistas
100 μL
505,00 €

About This Item

Número MDL:
Código UNSPSC:
12352203
Atlas de proteínas humanas número:
NACRES:
NA.41

505,00 €


Póngase en contacto con nuestro Servicio de Atención al Cliente para disponibilidad

origen biológico

rabbit

Nivel de calidad

conjugado

unconjugated

forma del anticuerpo

affinity isolated antibody

tipo de anticuerpo

primary antibodies

clon

polyclonal

Línea del producto

Prestige Antibodies® Powered by Atlas Antibodies

Formulario

buffered aqueous glycerol solution

reactividad de especies

human

validación mejorada

recombinant expression
RNAi knockdown
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

técnicas

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:200-1:500

secuencia del inmunógeno

DEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSG

Nº de acceso UniProt

aplicaciones

research pathology

Condiciones de envío

wet ice

temp. de almacenamiento

−20°C

modificación del objetivo postraduccional

unmodified

Información sobre el gen

human ... DAXX(1616)

Descripción general

DAXX (death-domain associated protein) is a nuclear protein, which is highly conserved in nature. It shuttles between nucleus and cytoplasm.[1] It was originally identified as a FAS-interacting protein, which induces FAS-mediated apoptosis. This gene is localized to human chromosome 6p21.3 in the MHC (major histocompatibility complex) locus. The encoded protein contains FAS-binding region in its C-terminal. It contains two putative nuclear localization signals.

Inmunógeno

Death domain-associated protein 6 recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-DAXX antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry[2] against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Acciones bioquímicas o fisiológicas

DAXX (death-domain associated protein) plays essential roles in control of transcription and viral infection and carcinogenesis. It controls multiple signaling pathways involved in cell survival and death. It forms a constitutive constituent of promyleocytic leukaemia protein (PML) nuclear bodies (PML-NBs). In human papillomavirus (HPV)-induced cervical carcinoma, this protein translocates gradually from nucleus to nuclear membrane to cytoplasm to plasma membrane.[1] It acts as a bifunctional protein at centrosomic/pericentrosomic heterochromatin, where it controls the loading of heat shock protein H3.3 under normal conditions and the protection epigenetic identity of heterochromatin during stress conditions. The subcellular localization of this protein determines the sensitivity of macrophages to oxidized low density lipoprotein (ox-LDL), where its nuclear localization can negate the effect of ox-LDL.

Características y beneficios

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST86890

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Código de clase de almacenamiento

10 - Combustible liquids

Clase de riesgo para el agua (WGK)

WGK 1

Equipo de protección personal

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

The Daxx enigma.
Michaelson J S
Apoptosis, 5(3), 217-220 (2000)
Christian Geis et al.
The Journal of surgical research, 194(2), 388-393 (2014-12-03)
Neuroendocrine tumors (NETs) of the ileum are sporadic tumors derived from submucosal gastrointestinal stem cells. They often show clinical symptoms only after hepatic metastasation when curative therapy is limited or impossible. In this study, we analyzed the expression of the
Guozuo Xiong et al.
Molecular biology reports, 41(11), 7183-7190 (2014-08-15)
Here we aimed to evaluate the effects of DAXX subcellular localization on ox-LDL induced macrophages apoptosis. Cytoplasmic localization vector DAXX-W621A and nuclear localization vector DAXX-S667A were constructed by point mutation in DAXX. Blank vector, full length DAXX, DAXX-W621A, DAXX-S667A was
Epigenetic dysregulation and poorer prognosis in DAXX-deficient pancreatic neuroendocrine tumours.
Christodoulos P Pipinikas et al.
Endocrine-related cancer, 22(3), L13-L18 (2015-04-23)
Aatur D Singhi et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 23(2), 600-609 (2016-07-14)
Pancreatic neuroendocrine tumors (PanNET) are a heterogeneous group of neoplasms with increasing incidence and unpredictable behavior. Whole-exome sequencing has identified recurrent mutations in the genes DAXX and ATRX, which correlate with loss of protein expression and alternative lengthening of telomeres

Preguntas

Revisiones

Sin puntuación

Filtros activos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico