HPA005546

Anti-DLGAP5 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-DLG7 antibody produced in rabbit, Anti-Discs large homolog 7 antibody produced in rabbit, Anti-HURP antibody produced in rabbit, Anti-Hepatoma up-regulated protein antibody produced in rabbit
• Código UNSPSC: 12352203
• Atlas de proteínas humanas número: HPA005546
• NACRES: NA.41

Propiedades

• origen biológico: rabbit
• Nivel de calidad: 100
• conjugado: unconjugated
• forma del anticuerpo: affinity isolated antibody
• tipo de anticuerpo: primary antibodies
• clon: polyclonal
• Línea del producto: Prestige Antibodies^® Powered by Atlas Antibodies
• formulario: buffered aqueous glycerol solution
• reactividad de especies: human
• validación mejorada: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• técnicas: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• secuencia del inmunógeno: ASRHRKDISTEMIRTKIAHRKSLSQKENRHKEYERNRHFGLKDVNIPTLEGRILVELDETSQGLVPEKTNVKPRAMKTILGDQRKQMLQKYKEEKQLQKLKEQREKAKRGIFKVGRYRPDMPCFLLSNQNAVKAE
• Nº de acceso UniProt: Q15398
• Condiciones de envío: wet ice
• temp. de almacenamiento: −20°C
• modificación del objetivo postraduccional: unmodified
• Información sobre el gen: human ... DLGAP5(9787)

Descripción

Descripción general

DLGAP5 (discs, large (Drosophila) homolog-associated protein 5) is a microtubule associated protein. It is also a gene regulated by cell cycle. During mitosis, it localizes to spindle poles. In humans, DLGAP5 gene is mapped to chromosome 14q22-23, and consists of 19 exons. This protein consists of a putative nuclear export signal (NES), which is rich in leucine, a coiled-coil domain, two destruction boxes (D-box), and a KEN box. It also consists of GKAP homology domain 1 (GH1), which is made up of ~100 amino acids. DLGAP5 protein is highly expressed in normal tissues with high level of proliferation, such as testis, thymus, fetal liver, and colon.

Inmunógeno

Discs large homolog 7 recombinant protein epitope signature tag (PrEST)

Aplicación

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Acciones bioquímicas o fisiológicas

DLGAP5 (discs, large (Drosophila) homolog-associated protein 5) is a substrate for Aurora A, which regulates its accessibility and binding to mitotic spindle. It also facilitates the assembly of mitotic spindle and helps in chromosome segregation. During mitosis, it mediates the inter-kinetochore tension. Aberrant increase in DLGAP5 expression results in abnormal spindle function, leading to aneuploidy and tumorigenesis. It has potential as a marker for early detection of bladder cancer and bilharzial bladder cancer. Overexpression of DLGAP5 and its truncated form KIAA0008 is linked with human colon cancer, breast cancer, hepatocellular carcinoma, and transitional cell carcinoma. It has been suggested that it acts as an oncogene, as it suppresses p53, which is a tumor suppressor gene. DLGAP5 gene has potential to determine the prognosis of high-risk prostate cancer.

Características y beneficios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligadura / enlace

Corresponding Antigen APREST70349

Forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Información legal

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Cláusula de descargo de responsabilidad

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Código de clase de almacenamiento: 10 - Combustible liquids
• Clase de riesgo para el agua (WGK): WGK 1
• Punto de inflamabilidad (°F): Not applicable
• Punto de inflamabilidad (°C): Not applicable
• Equipo de protección personal: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)