AV53281

Anti-FUNDC1 (AB2) antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-FUN14 domain containing 1, Anti-MGC51029
• NACRES: NA.41
• UNSPSC Code: 12352203
• Conjugate: unconjugated
• Clone: polyclonal
• Application: WB
• Citations: -

Propiedades

• biological source: rabbit
• Quality Segment: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 17 kDa
• species reactivity: dog, guinea pig, bovine, rabbit, rat, horse, mouse, human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_776155
• UniProt accession no.: Q8IVP5
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... FUNDC1(139341)

Descripción

Immunogen

Synthetic peptide directed towards the middle region of human FUNDC1

Biochem/physiol Actions

FUNDC1 belongs to the FUN14 family. The exact function of FUNDC1 remains unknown.

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Other Notes

Synthetic peptide located within the following region: TAVGGGFLLLQIASHSGYVQIDWKRVEKDVNKAKRQIKKRANKAAPEINN

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Clase de almacenamiento: 10 - Combustible liquids
• ¿Qué está pasando?: WGK 3
• Punto de inflamación (°F): Not applicable
• Punto de inflamación (°C): Not applicable