Synthetic peptide directed towards the N terminal region of human TNNI2
Aplicación
Anti-TNNI2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.
Acciones bioquímicas o fisiológicas
Troponin I type 2 (TNNI2) is a fast-twitch muscle protein belonging to the troponin I gene family. It forms a complex that regulates striated muscle contraction along with troponins T and C. TNNI2 also has a role in smooth muscle contraction, angiogenesis, metastasis and tumor growth. Mutations in TNNI2 gene have been implicated in myopathy1 and distal arthrogryposis type 2B.
Secuencia
Synthetic peptide located within the following region: PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL
Forma física
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Cláusula de descargo de responsabilidad
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Science in China. Series C, Life sciences, 50(1), 93-100 (2007-03-30)
To explore the efficiency and mechanism of ovarian carcinoma gene therapy with the human fast-twitch skeletal muscle troponin I gene (Tnl-fast), Tnl-fast cDNA was transferred into human ovarian adenocarcinoma cell-line SK-OV-3. In vitro, the cell growth and cell cycle of
To describe a three-generation family with distal arthrogryposis associated with myopathy and caused by a mutation in the gene encoding for sarcomeric thin filament protein troponin I, TNNI2. The authors performed clinical investigations and reviewed medical records. Muscle biopsy specimens
Distal arthrogryposis (DA) is composed of a group of clinically and genetically heterogeneous disorders, characterized by multiple congenital contractures of the limbs. Point mutations in three genes encoding contractile fast-twitch myofibers, TPM2, TNNI2 and TNNT3, were recently identified in DA
Preguntas
Revisiones
★★★★★ Sin puntuación
Filtros activos
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.